SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000404438 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000404438
Domain Number 1 Region: 52-103
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000048
Family HLH, helix-loop-helix DNA-binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000404438   Gene: ENSG00000165643   Transcript: ENST00000425225
Sequence length 387
Comment pep:known chromosome:GRCh37:9:138585257:138591374:-1 gene:ENSG00000165643 transcript:ENST00000425225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCSEPYPEVSRIPTVRGCNGSLSGALSCCEDSARGSGPPKAPTVAEGPSSCLRRNVI
SERERRKRMSLSCERLRALLPQFDGRREDMASVLEMSVQFLRLASALGPSQEQHAILASS
KEMWHSLQEDVLQLTLSSQIQAGVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPV
PHILASSRQWDPASCTSLGTDKCEALLGLCQVRGGLPPFSEPSSLVPWPPGRSLPKAVRP
PLSWPPFSQQQTLPVMSGEALGWLGQAGPLAMGAAPLGEPAKEDPMLAQEAGSALGSDVD
DGTSFLLTAGPSSWPGSLEGRGGSGPAWAPAESSPLDVGEPGFLGDPELGSQELQDSPLE
PWGLDVDCAGLALKDEVESIFPDFFAC
Download sequence
Identical sequences ENSP00000404438 9606.ENSP00000404438 ENSP00000404438 ENSP00000404438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]