SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000406147 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406147
Domain Number 1 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.56e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 301-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.76e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 416-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-23
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 2-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-21
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 6 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.76e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 509-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.32e-17
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 9 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000354
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406147   Gene: ENSG00000197134   Transcript: ENST00000435820
Sequence length 563
Comment pep:known chromosome:GRCh37:19:22235266:22273901:1 gene:ENSG00000197134 transcript:ENST00000435820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLTIRDVTVEFSLEEWHCLDTAQQNLYRDVMLENYRNLVFLGIAVSKPDLITCLEQGK
EPCNMKRHEMVAKPPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQLRKGCKSV
DECKVCKGGYNGLNQCLITTQSKMYQCDKYVKVFYKFSNSDRHKIRHTEKKTCKCKECGK
SFCMLSQLTRHKRIHIRENSHKCEECGKAFNQSSALTRHKMTHTGEKPYKCEECGKAFNR
SSHLTQHKVIHTREKPYKCEECGKAFNRSSHITQHKRIHNREKPFKYDECCKAFKWSSAL
TTLTQHKRIHTGEKPYKCEECGKAFNQSSALTRHKMIHTGEKPFQCEECGKAFNRSSHLT
QHKIIHTKEKPYKCEECGKAFNRSSHLTKHKRIHTREKAYKCDEYCKAFNWSSALTTLTQ
HKIIHTGEKPYKCEECGKAFNRSSYLIRHKIIHTGEKPYKCEECGKAFNQSSHLTQHKII
HTGEKPYKCEECGKAFNRSSHLSQHKIIHTGEKPYKCEECGKPFNRFSYLTVHKRIHAGE
NPNKYEECGKACNHSSNLTKHNS
Download sequence
Identical sequences Q9Y2Q1
ENSP00000470209 9606.ENSP00000406147 gi|148612807|ref|NP_258429.2| NP_258429.2.87134 NP_258429.2.92137 ENSP00000406147 ENSP00000470209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]