SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000409295 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409295
Domain Number 1 Region: 396-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 77-137
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 732-789
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 676-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 564-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.79e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 788-845
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.04e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 844-901
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 8 Region: 508-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 9 Region: 620-677
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 10 Region: 452-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 11 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 12 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.93e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 13 Region: 886-938
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-20
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSP00000409295
Domain Number - Region: 236-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0436
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409295   Gene: ENSG00000090612   Transcript: ENST00000416488
Sequence length 947
Comment pep:known chromosome:GRCh37:12:133707570:133778955:1 gene:ENSG00000090612 transcript:ENST00000416488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRVRTASIWVPPLQERNSSWDRIRKLQGQESILGQGTPGLQPLPGTPRQKQKSRRIEK
VLEWLFISQEQPKITKSWGPLSFMDVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSL
GYQHTKPDIIFKLEQGEELCMVQAQVPNQTCPNTVWKIDDLMDWHQENKDKLGSTAKSFE
CTTFGKLCLLSTKYLSRQKPHKCGTHGKSLKYIDFTSDYARNNPNGFQVHGKSFFHSKHE
QTVIGIKYCESIESGKTVNKKSQLMCQQMYMGEKPFGCSCCEKAFSSKSYLLVHQQTHAE
EKPYGCNECGKDFSSKSYLIVHQRIHTGEKLHECSECRKTFSFHSQLVIHQRIHTGENPY
ECCECGKVFSRKDQLVSHQKTHSGQKPYVCNECGKAFGLKSQLIIHERIHTGEKPYECNE
CQKAFNTKSNLMVHQRTHTGEKPYVCSDCGKAFTFKSQLIVHQGIHTGVKPYGCIQCGKG
FSLKSQLIVHQRSHTGMKPYVCNECGKAFRSKSYLIIHTRTHTGEKLHECNNCGKAFSFK
SQLIIHQRIHTGENPYECHECGKAFSRKYQLISHQRTHAGEKPYECTDCGKAFGLKSQLI
IHQRTHTGEKPFECSECQKAFNTKSNLIVHQRTHTGEKPYSCNECGKAFTFKSQLIVHKG
VHTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPYGCSECGKAFRSKSYLIIHMRTHTG
EKPHECRECGKSFSFNSQLIVHQRIHTGENPYECSECGKAFNRKDQLISHQRTHAGEKPY
GCSECGKAFSSKSYLIIHMRTHSGEKPYECNECGKAFIWKSLLIVHERTHAGVNPYKCSQ
CEKSFSGKLRLLVHQRMHTREKPYECSECGKAFIRNSQLIVHQRTHSGEKPYGCNECGKT
FSQKSILSAHQRTHTGEKPCKCTECGKAFCWKSQLIMHQRTHVDDKH
Download sequence
Identical sequences Q14587
gi|23308729|ref|NP_003406.1| gi|259490318|ref|NP_001159353.1| hso003011774.8 ENSP00000228289 ENSP00000444412 ENSP00000409295 9606.ENSP00000228289 ENSP00000228289 ENSP00000444412 NP_001159353.1.87134 NP_001159353.1.92137 NP_003406.1.87134 NP_003406.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]