SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411032 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411032
Domain Number 1 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 184-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 351-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.18e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 426-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.85e-17
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000111
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 8 Region: 520-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000424
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 148-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000215
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411032   Gene: ENSG00000186026   Transcript: ENST00000421176
Sequence length 593
Comment pep:known chromosome:GRCh37:19:44576297:44593766:1 gene:ENSG00000186026 transcript:ENST00000421176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMFKEAVTFKDVAVVFTEEELGLLDVSQRKLYRDVMLENFRNLLSVGHQLSHRDTFHFQ
REEKFWIMETATQREGNSGGKIQTELESVPETGPHEEWSCQQIWEQTASELTRPQDSISS
SQFSTQGDVPSQVDAGLSIIHIGETPSEHGKCKKFFSDVSILDLHQQLHSGKISHTCNEY
RKRFCYSSALCLHQKVHMGEKRYKCDVCSKAFSQNSQLQTHQRIHTGEKPFKCEQCGKSF
SRRSGMYVHCKLHTGEKPHICEECGKAFIHNSQLREHQRIHTGEKPFKCYICGKSFHSRS
NLNRHSMVHMQEKSFRCDTCSNSFGQRSALNSHCMDHTKEKLYKCEECGRSFTCRQDLCK
HQMDHTGDKPYNCNVCGKGFRWSSCLSRHQRVHNGETTFKCDGCGKRFYMNSQGHSHQRA
YREEELYKCQKCGKGYISKFNLDLHQRVHTGERPYNCKECGKSFRWASGILRHKRLHTGE
KPFKCEECGKRFTENSKLRFHQRIHTGEKPYKCEECGKGFRWASTHLTHQRLHSREKLFQ
CEDCGKSSEHSSCLQDQQSDHSGEKTSKCEDCGKRYERRLNLDMILSLFLNDI
Download sequence
Identical sequences Q2VY69
ENSP00000411032 gi|83716019|ref|NP_001032902.1| ENSP00000411032 9606.ENSP00000328801 NP_001032902.1.87134 NP_001032902.1.92137 XP_011525209.1.92137 XP_011525210.1.92137 ENSP00000411032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]