SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411397 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411397
Domain Number 1 Region: 53-331
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-90
Family Protein kinases, catalytic subunit 0.0000185
Further Details:      
 
Domain Number 2 Region: 665-776
Classification Level Classification E-value
Superfamily KA1-like 2.13e-47
Family Kinase associated domain 1, KA1 0.00000324
Further Details:      
 
Weak hits

Sequence:  ENSP00000411397
Domain Number - Region: 350-388
Classification Level Classification E-value
Superfamily UBA-like 0.0201
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411397   Gene: ENSG00000075413   Transcript: ENST00000429436
Sequence length 776
Comment pep:known chromosome:GRCh37:14:103851857:103970163:1 gene:ENSG00000075413 transcript:ENST00000429436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLK
TIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFE
VIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQGCQAGQTIKVQVSFDLLSL
MFTFIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPP
YAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMS
TDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVG
MGYSQEEIQESLSKMKYDEITATYLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNST
GQSPHHKVQRSVFSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSG
SAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTAD
RHSVIQNGKENSTIPDQRTPVASTHSISSAATPDRIRFPRGTASRSTFHGQPRERRTATY
NGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRRNMSFRFIKRLPTEYERNGRYEG
SSRNVSAEQKDENKEAKPRSLRFTWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRERFL
LFCVHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Download sequence
Identical sequences ENSP00000335347 ENSP00000411397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]