SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000413660 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413660
Domain Number 1 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.96e-25
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 178-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.53e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 457-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.04e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 121-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 1-28
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000759
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413660   Gene: ENSG00000229676   Transcript: ENST00000456783
Sequence length 531
Comment pep:known chromosome:GRCh37:19:22817126:22850472:1 gene:ENSG00000229676 transcript:ENST00000456783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYRNLVFVGIAASKPDLITCLEQGKEPWNVKRHEMVAEPPVVCSYFARDLWPKQGKK
NYFQKVILRRYKKCGCENLQLRKYCKSMDECKVHKECYNGLNQCLTTTQNKIFQCDKYVK
VFHKFSNSNRHTIRHTGKKSFKCKECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYNE
TSNLSTHKRIHTGKKPYKCEECGKAFNRLSHLTTHKIIHTGKKPYKCEECGKAFNQSANL
TTHKRIHTGEKPYKCEECGRAFSQSSTLTAHKIIHAGEKPYKCEECGKAFSQSSTLTTHK
IIHTGEKFYKCEECGKAFSQLSHLTTHKRIHSGEKPYKCEECGKAFKQSSTLTTHKRIHA
GEKFYKCEVCSKAFSRFSHLTTHKRIHTGEKPYKCEECGKAFNLSSQLTTHKIIHTGEKP
YKCEECGKAFNQSSTLSKHKVIHTGEKPYKYEECGKAFNQSSHLTTHKMIHTGEKPYKCE
ECGKAFNNSSILNRHKMIHTGEKLYKPESCNNACDNIAKISKYKRNCAGEK
Download sequence
Identical sequences Q9P255
9606.ENSP00000413660 ENSP00000413660 NP_065906.1.87134 NP_065906.1.92137 ENSP00000413660 ENSP00000413660 gi|148806865|ref|NP_065906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]