SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414887 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414887
Domain Number 1 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.74e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.63e-25
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 506-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.42e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 202-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414887   Gene: ENSG00000234284   Transcript: ENST00000444149
Sequence length 563
Comment pep:known chromosome:GRCh37:5:178450753:178462065:1 gene:ENSG00000234284 transcript:ENST00000444149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRLLPAHVQESVTFRDVAVFFSQDEWLHLDSAQRALYREVMLENYSILVSLGILFSKP
KVISQLEQGEDPWMVESGVPQGAHLGWESLFGTIVSKEENQEVMKKLIIDGTFDFKLEKT
YINEDKLEKQQGKKNRLFSKVLVTIKKVYMKERSFKGVEFGKNLGLKSSLIRKPRIVSRG
RRPRSQQYSVLFKQLGVNTVRKCYKCNICGKIFLHSSSLSKHQRIHTGEKLYKCKECRKA
FSQSSSLTQHLRVHTGEKPYICSECGKAFSFTTSLIGHQRMHTGERPYKCKECGKTFKGS
SSLNNHQRIHTGEKPYKCNECGRAFSQCSSLIQHHRIHTGEKPYECTQCGKAFTSISRLS
RHHRIHTGEKPFHCNECGKVFSYHSALIIHQRIHTGEKPYACKECGKAFSQSSALIQHQR
IHTGEKPYKCNECGKAFSWISRLNIHHRIHTGEKPYNCKECGKAFSSHSGVNTHRKIHTG
EKPYKCNDCEKAFNQSSALIQHQRIHTGEKPYNCKVCGKAFRQSSSLMTHMRIHTGEKPY
KCKECGKAFSQSSSLTNHQRTHN
Download sequence
Identical sequences B4DU55
ENSP00000414887 NP_001129588.1.87134 NP_001129588.1.92137 XP_005265965.1.92137 XP_011532852.1.92137 XP_011532853.1.92137 ENSP00000414887 9606.ENSP00000414887 gi|209870092|ref|NP_001129588.1| ENSP00000414887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]