SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000415774 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000415774
Domain Number 1 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-25
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.17e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 482-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.46e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 524-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.85e-17
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 189-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-16
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 9 Region: 149-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000411
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000415774   Gene: ENSG00000186777   Transcript: ENST00000419098
Sequence length 585
Comment pep:known chromosome:GRCh37:4:264464:299110:-1 gene:ENSG00000186777 transcript:ENST00000419098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLTFRDVAIEFSPEEWKCLDPAQQNLYRDVMLENYRNLISLGVAISNPDLVIYLEQRK
EPYKVKIHETVAKHPAVCSHFTQDFLPVQGIEDSFHKLILRRYEKCGHENLELRKSCKRK
VQKGGYNEFNQCLSTIQSKIFQCNVHVKVFSTFSNSNQRRIRHTGEKHFKECGKSFQKFS
DLTQHQGIHAGEKPYTCEECGKDFKWYLIFNEYEIIHTGEKPFTCEECGNIFTTSSNFAK
HKVHTGEKSYKYEECGKAFNRSSTLTKHKRIHAEEKPFTCEECGKIITSSSNVAKHKKIH
TGEKLYKCQECGKVFNRSTTLTKHNRIHTGEKPYTCEECGKAFSRSSVLNEHKRIHTGEK
PYKCEQCGKAFRQSATLNKHKSIHTGEKPYTCEECGKAFSRFTTLNEHKRIHTGERPHKC
EECGKAFGWSTDLNKHKIIHTGEKPYKCEECGKAFGWSAYLSKHKKIHTGEKPYRCEECG
KAFLCSRALNKHKTIHTGEKPYECEECGKAFGWSTYLSKHKKIHTGEKPYRCEECGKAFR
RSRVLNKYKTIHTGDKTPKCKGCGKAFKWSSYLNQHNKIYTGEKL
Download sequence
Identical sequences B4DXR9
ENSP00000415774 ENSP00000415774 NP_001131080.1.87134 NP_001131080.1.92137 ENSP00000415774 ENSP00000476843 gi|212549576|ref|NP_001131080.1| 9606.ENSP00000415774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]