SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417577 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417577
Domain Number 1 Region: 570-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-27
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-25
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 3 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.2e-24
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 514-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 612-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 8 Region: 654-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 9 Region: 293-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000535
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417577   Gene: ENSG00000196597   Transcript: ENST00000478850
Sequence length 699
Comment pep:known chromosome:GRCh37:9:99581690:99616642:-1 gene:ENSG00000196597 transcript:ENST00000478850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTFQASVSFQDVTVEFSQEEWQHMGPVERTLYRDVMLENYSHLVSVGYCFTKPELIFTL
EQGEDPWLLEKEKGFLSRNSPEDSQPDEISEKSPENQGKHLLQVLFTNKLLTTEQEISGK
PHNRDINIFRARMMPCKCDIAGSACQGLSLMAPHCQYSKEKAHERNVCDKWLISIKDGRT
NTQEKSFAYSKIVKTLHHKEEVIQHQTIQTLGQDFEYNESRKAFLEKAALVTSNSTHPKG
KSYNFNKFGENKYDKSTFIIPQNMNPEKSHYEFNDTGNCFCRITHKTLTGGKSFSQKSHI
REHHRVHIGVKPFEYGKSFNRNSTLPVHQRTHATDKYSDYHPCTETFSYQSTFSVHQKVH
IRAKPYEYNECGKSCSMNSHLIWPQKSHTGEKPYECPECGKAFSEKSRLRKHQRTHTGEK
PYKCDGCDKAFSAKSGLRIHQRTHTGEKPFECHECGKSFNYKSILIVHQRTHTGEKPFEC
NECGKSFSHMSGLRNHRRTHTGERPYKCDECGKAFKLKSGLRKHHRTHTGEKPYKCNQCG
KAFGQKSQLRGHHRIHTGEKPYKCNHCGEAFSQKSNLRVHHRTHTGEKPYQCEECGKTFR
QKSNLRGHQRTHTGEKPYECNECGKAFSEKSVLRKHQRTHTGEKPYNCNQCGEAFSQKSN
LRVHQRTHTGEKPYKCDKCGRTFSQKSSLREHQKAHPGD
Download sequence
Identical sequences Q6ZMW2
ENSP00000417577 ENSP00000419397 ENSP00000440624 ENSP00000419397 NP_001001662.1.87134 NP_001001662.1.92137 XP_005251799.1.92137 XP_011516617.1.92137 XP_011516620.1.92137 9606.ENSP00000419397 gi|48717244|ref|NP_001001662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]