SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000419033 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419033
Domain Number 1 Region: 332-453
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 204-326
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000942
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 165-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000725
Family EGF-type module 0.019
Further Details:      
 
Domain Number 4 Region: 421-451,508-588
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000643
Family Growth factor receptor domain 0.0053
Further Details:      
 
Domain Number 5 Region: 127-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSP00000419033
Domain Number - Region: 1020-1159
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00487
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number - Region: 816-945
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.022
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number - Region: 1476-1505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0605
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419033   Gene: ENSG00000162591   Transcript: ENST00000485002
Sequence length 1541
Comment pep:known chromosome:GRCh37:1:3406484:3440810:-1 gene:ENSG00000162591 transcript:ENST00000485002 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSFLEEARAAGRAVVLALVLLLLPAVPVGASVPPRPLLPLQPGMPHVCAEQELTLVGRRQ
PCVQALSHTVPVWKAGCGWQAWCVGHERRTVYYMGYRQVYTTEARTVLRCCRGWMQQPDE
EGCLSAECSASLCFHGGRCVPGSAQPCHCPPGFQGPRCQYDVDECRTHNGGCQHRCVNTP
GSYLCECKPGFRLHTDSRTCLAINSCALGNGGCQHHCVQLTITRHRCQCRPGFQLQEDGR
HCVRRSPCANRNGSCMHRCQVVRGLARCECHVGYQLAADGKACEDVDECAAGLAQCAHGC
LNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHTSAGPLCTCPRG
YELDTDQRTCIDVDDCADSPCCQQVCTNNPGGYECGCYAGYRLSADGCGCEDVDECASSR
GGCEHHCTNLAGSFQCSCEAGYRLHEDRRGCSPLEEPMVDLDGELPFVRPLPHIAVLQDE
LPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDCRNGGTCLLGLDGC
DCPEGWTGLICNETCPPDTFGKNCSFSCSCQNGGTCDSVTGACRCPPGVSGTNCEDGCPK
GYYGKHCRKKCNCANRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEECQCVQPH
TQSCDKRDGSCSCKAGFRGERCQAECELGYFGPGCWQACTCPVGVACDSVSGECGKRCPA
GFQGEDCGQECPVGTFGVNCSSSCSCGGAPCHGVTGQCRCPPGRTGEDCEADCPEGRWGL
GCQEICPACQHAARCDPETGACLCLPGFVGSRCQDVCPAGWYGPSCQTRCSCANDGHCHP
ATGHCSCAPGWTGFSCQRACDTGHWGPDCSHPCNCSAGHGSCDAISGLCLCEAGYVGPRC
EQQCPQGHFGPGCEQRCQCQHGAACDHVSGACTCPAGWRGTFCEHACPAGFFGLDCRSAC
NCTAGAACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQACACFNGASCDPVHGQCHC
APGWMGPSCLQACPAGLYGDNCRHSCLCQNGGTCDPVSGHCACPEGWAGLACEKECLPRD
VRAGCRHSGGCLNGGLCDPHTGRCLCPAGWTGDKCQSPCLRGWFGEACAQRCSCPPGAAC
HHVTGACRCPPGFTGSGCEQACPPGSFGEDCAQMCQCPGENPACHPATGTCSCAAGYHGP
SCQQRCPPGRYGPGCEQLCGCLNGGSCDAATGACRCPTGFLGTDCNLTCPQGRFGPNCTH
VCGCGQGAACDPVTGTCLCPPGRAGVRCERGCPQNRFGVGCEHTCSCRNGGLCHASNGSC
SCGLGWTGRHCELACPPGRYGAACHLECSCHNNSTCEPATGTCRCGPGFYGQACEHPCPP
GFHGAGCQGLCWCQHGAPCDPISGRCLCPAGFHGHFCERGCEPGSFGEGCHQRCDCDGGA
PCDPVTGLCLCPPGRSGATCNLDCRRGQFGPSCTLHCDCGGGADCDPVSGQCHCVDGYMG
PTCREGGPLRLPENPSLAQGSAGTLPASSRPTSRSGGPARH
Download sequence
Identical sequences O75095
ENSP00000348982 9606.ENSP00000348982 ENSP00000419033 ENSP00000348982 gi|110347457|ref|NP_001400.3| NP_001400.3.87134 NP_001400.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]