SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419692 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419692
Domain Number 1 Region: 201-458
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.77e-83
Family Nuclear receptor ligand-binding domain 0.000000000816
Further Details:      
 
Domain Number 2 Region: 132-213
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.48e-31
Family Nuclear receptor 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419692   Gene: ENSG00000186350   Transcript: ENST00000481739
Sequence length 462
Comment pep:known chromosome:GRCh37:9:137218426:137328865:1 gene:ENSG00000186350 transcript:ENST00000481739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Download sequence
Identical sequences F1D8Q5 H9FY76 P19793
HR4643 IGBMC-0017-000 9606.ENSP00000419692 NP_002948.1.87134 NP_002948.1.92137 XP_014971889.1.72884 ENSP00000419692 ENSP00000470812 gi|4506755|ref|NP_002948.1| ENSP00000419692 ENSP00000419692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]