SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420111 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420111
Domain Number 1 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-23
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 3 Region: 489-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 268-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.28e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 535-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 209-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 157-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-16
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420111   Gene: ENSG00000213988   Transcript: ENST00000469078
Sequence length 601
Comment pep:known chromosome:GRCh37:19:20188803:20237827:1 gene:ENSG00000213988 transcript:ENST00000469078 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGPLEFRDVAIEFSLEEWHCLDTAQQNLYRDVMLENYRHLVFLGIVVTKPDLITCLEQGK
KPFTVKRHEMIAKSPVMCFHFAQDLCPEQSLKDSFQKVIVTRYEKREYGNLELKKGCESV
DEGKVHKRGYNGLNQCLTATQSKVFQCDTYVKVSHIFSNSNRHKIRDTGKKPFKCIECGK
AFNQSSTLATHKKIHTGEITCKCEECGKAFNRSSHLTSHKRIHTGEKRYKCEDCGKELKY
SSTLTAHKRIHTGEKRYKCEDCGKELKYSSTLTAHKRIHTGEKPYKCDKCGRAFISSSIL
YVHKISHTEEKPYKCEECGKAFKLSSILSTHKRIHTGEKPYKCEECGKAFRRSLVLRTHK
RIHTGEKPYKCDKCGKAFISSSLLYKHKISHSEKKPYKCEECGKAFKRSSTLTIHKISHT
EEKPYKCQECDKVFKRSSALSTHKIIHSGEKPYKCEECGKAFKRSSNLTTHKISHTEEKL
YKCQECDKAFKYSSALSTHKIIHSGENPYKCEECGKAFKRSSVLSKHKIIHTGAKPYKCE
ECGKAFKRSSQLTSHKISHTGEKPYKCEECGKAFNLSSDLNTHKRIHIGQKAYIVKNMAN
L
Download sequence
Identical sequences Q03938
NP_009069.1.87134 NP_009069.1.92137 ENSP00000420111 ENSP00000458090 ENSP00000410466 ENSP00000410466 ENSP00000458013 gi|209862791|ref|NP_009069.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]