SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000423602 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423602
Domain Number 1 Region: 162-255
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-29
Family Pleckstrin-homology domain (PH domain) 0.0000049
Further Details:      
 
Domain Number 2 Region: 28-132
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-27
Family SH2 domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423602   Gene: ENSG00000070190   Transcript: ENST00000512369
Sequence length 280
Comment pep:known chromosome:GRCh37:4:100738003:100789871:1 gene:ENSG00000070190 transcript:ENST00000512369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLL
RDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
TLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK
Download sequence
Identical sequences G3QFN7 H2QPY0 Q9UN19
ENSGGOP00000001114 ENSPTRP00000060568 NP_055210.2.87134 NP_055210.2.92137 XP_003829986.1.60992 XP_004040230.1.27298 XP_517361.2.37143 ENSP00000423602 ENSP00000423602 9598.ENSPTRP00000028016 9606.ENSP00000296414 ENSPTRP00000028016 gi|158631203|ref|NP_055210.2| ENSP00000423602 hsi002011017.1 ENSGGOP00000001114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]