SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000425471 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425471
Domain Number 1 Region: 729-785
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 785-841
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 561-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 673-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 617-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 841-892
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 525-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.1e-16
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 8 Region: 27-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000719
Family KRAB domain (Kruppel-associated box) 0.0052
Further Details:      
 
Domain Number 9 Region: 245-364
Classification Level Classification E-value
Superfamily SET domain 0.000000311
Family Viral histone H3 Lysine 27 Methyltransferase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425471   Gene: ENSG00000164256   Transcript: ENST00000502755
Sequence length 894
Comment pep:known chromosome:GRCh37:5:23507264:23510136:1 gene:ENSG00000164256 transcript:ENST00000502755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPEKSQEESPEEDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKRNYNA
LITIGLRATRPAFMCHRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMALRVEQRKHQKGMP
KASFSNESSLKELSRTANLLNASGSEQAQKPVSPSGEASTSGQHSRLKLELRKKETERKM
YSLRERKGHAYKEVSEPQDDDYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSAL
SLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRITEDEEAANNGYSWLITKGRN
CYEYVDGKDKSWANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWYGDE
YGQELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPS
ARKLLQPENPCPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
KGQMGSCRVGKRIMEEESRTGQKVNPGNTGKLFVGVGISRIAKVKYGECGQGFSVKSDVI
THQRTHTGEKLYVCRECGRGFSWKSHLLIHQRIHTGEKPYVCRECGRGFSWQSVLLTHQR
THTGEKPYVCRECGRGFSRQSVLLTHQRRHTGEKPYVCRECGRGFSRQSVLLTHQRRHTG
EKPYVCRECGRGFSWQSVLLTHQRTHTGEKPYVCRECGRGFSWQSVLLTHQRTHTGEKPY
VCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQRTHTGEKPYVCRE
CGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRG
FRNKSHLLRHQRTHTGEKPYVCRECGRGFSDRSSLCYHQRTHTGEKPYVCREDE
Download sequence
Identical sequences Q9NQV7
ENSP00000425471 gi|147905620|ref|NP_064612.2| 9606.ENSP00000296682 ENSP00000296682 NP_064612.2.92137 ENSP00000296682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]