SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431265 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431265
Domain Number 1 Region: 4-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.57e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 7 Region: 472-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.34e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 151-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-18
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431265   Gene: ENSG00000181007   Transcript: ENST00000392161
Sequence length 532
Comment pep:known chromosome:GRCh37:19:36882862:36909558:-1 gene:ENSG00000181007 transcript:ENST00000392161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRSVMFSDVSIDFSPEEWEYLDLEQKDLYRDVMLENYSNLVSLGCFISKPDVISSLEQ
GKEPWKVVRKGRRQYPDLETKYETKKLSLENDIYEINLSQWKIMERIENHGLKGLILKND
WESTGKIEGQERPQEGYFSSVKMPSEKVSSYQKRTSVTPHQRLHFVDKPYECKECGKAFR
VRQQLTFHHRIHTGEKPYECKECGMAFRQTAHLTRHQRLHSGEKLYECKECGEAFICGAD
LRVHQKMHIGEKPYECKECGKAFRVRGQLTLHQRIHTGEKPYVCKECGKAFRQYAHLTRH
QKLNSADRLYECKECGKAFLCGSGLRVHHKLHTGEKPYECKECGKAFRVRQQLTLHQRIH
TGEKPYECKECGKTFSRGYHLILHHRIHTGEKPYECKECWKAFSRYSQLISHQSIHIGVK
PYDCKECGKAFRLLSQLTQHQSIHIGEKPYKCKECGKAFRLRQKLTLHQSIHTGEKPFEC
KECRKAFRLNSSLIQHLRIHSGEKPYECKECKKAFRQHSHLTHHLKIHNVKI
Download sequence
Identical sequences D3Y299 G3R596 H2QG63 Q8N141
ENSPTRP00000018664 9598.ENSPTRP00000018664 9606.ENSP00000313474 NP_597723.1.87134 NP_597723.1.92137 XP_004060648.1.27298 XP_524462.2.37143 gi|28274686|ref|NP_597723.1| ENSGGOP00000010466 ENSP00000431265 ENSP00000431265 ENSPTRP00000018664 ENSGGOP00000010466 ENSP00000431265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]