SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000438685 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000438685
Domain Number 1 Region: 231-362
Classification Level Classification E-value
Superfamily Cadherin-like 3.62e-31
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 445-553
Classification Level Classification E-value
Superfamily Cadherin-like 7.2e-27
Family Cadherin 0.00094
Further Details:      
 
Domain Number 3 Region: 128-235
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-23
Family Cadherin 0.0041
Further Details:      
 
Domain Number 4 Region: 341-445
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-19
Family Cadherin 0.0031
Further Details:      
 
Domain Number 5 Region: 31-96
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000514
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000438685   Gene: ENSG00000255622   Transcript: ENST00000539533
Sequence length 587
Comment pep:known chromosome:GRCh37:5:140535577:140538639:1 gene:ENSG00000255622 transcript:ENST00000539533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMETPLPKAPEKRQVTAIIFLLLLWEAGSATIKYSVLEERDSGSFVANLAKDLGLGVGEL
AARGARILSKGNKQYLQLERKSGNLLLKEKLDREELCGDIDPCILHFQMLLKNPVQFIQG
ELQLQDVNDHAPEFLENEILLKISEGSHPGTSFPLKIAQDLDVGSNTVQNYSISTNSYFH
LFTRNHSDGKKYPELVLDQALDREEQPQLRLTLTALDGGSPPRTGTSQVLIVIVDINDNV
PEFAQRRYEVQVPENTPIGSLVITVSARDLDAGTHGELSYSFFQYSNQIIQAFEINSITG
EIRFKKALDFEEIQSYHMEVEASDGGGLSGKCTVAIEVMDINDNAPELTMSLLISDILEN
SPETVVAVFGISDPDSGNNGKMMCSIQDHLPFLLKPTLENFYTLLTEGALDRESRAEYNI
TITVTDLGTPRLKTEYNITLRVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRD
SGTNAQVTYSLLPPQNPHLPLASLVSINTDNGHLFALRSLDYEALQEFEFRVGASDRGSP
ALSSEALVRVLVCWTPTTTRPSCCTRCRTAPRPAPSWCPGRPSRATW
Download sequence
Identical sequences Q96T98
ENSP00000438685 ENSP00000438685 ENSP00000477003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]