SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440403 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440403
Domain Number 1 Region: 412-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 188-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.99e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.36e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 244-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-23
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 7 Region: 39-86
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-20
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 8 Region: 150-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-18
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 9 Region: 514-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-16
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440403   Gene: ENSG00000181450   Transcript: ENST00000397097
Sequence length 580
Comment pep:known chromosome:GRCh37:1:227751244:227843529:1 gene:ENSG00000181450 transcript:ENST00000397097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGHPESRKTRRILTMLPRLVLNSFPQVILLPNPPKVLRLQGLLAFSDVVIEFSPEEWAC
LDPAQRNLYRDVMFENYRNLVSLAILSYSIQDLLPEQDMKDLCQKVTLTRHRSWGLDNLH
LVKDWRTVNEGKGQKEYCNRLTQCSSTKSKIFQCIECGRNFSWRSILTEHKRIHTGEKPY
KCEECGKVFNRCSNLTKHKRIHTGEKPYKCDECGKVFNWWSQLTNHKKIHTGEKPYKCDE
CDKVFNWWSQLTSHKKIHSGEKPYPCEECGKAFTQFSNLTQHKRIHTGEKPYKCKECCKA
FNKFSNLTQHKRIHTGEKPYKCEECGNVFNECSHLTRHRRIHTGEKPYKCEECGKAFTQF
ASLTRHKRIHTGEKPYQCEECGKTFNRCSHLSSHKRIHTGEKPYKCEECGRTFTQFSNLT
QHKRIHTGEKPYKCKECGKAFNKFSSLTQHRRIHTGVKPYKCEECGKVFKQCSHLTSHKR
IHTGEKPYKCKECGKAFYQSSILSKHKRIHTEEKPYKCEECGKAFNQFSSLTRHKRIHTG
EKRYKCKECGKGFYQSSIHSKYKRIYTGEEPDKCKKCGSL
Download sequence
Identical sequences gi|282395053|ref|NP_848644.2| ENSP00000440403 ENSP00000440403 NP_848644.2.87134 NP_848644.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]