SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000447987 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447987
Domain Number 1 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 3-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.6e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-20
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 5 Region: 422-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.91e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 184-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 7 Region: 339-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000231
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 8 Region: 138-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000193
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447987   Gene: ENSG00000257482   Transcript: ENST00000550760
Sequence length 499
Comment pep:known chromosome:GRCh37:7:63505821:63538927:1 gene:ENSG00000257482 transcript:ENST00000550760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLTFRDVAVEFSPEEWECLDSAQQRLYRDVMLENYGNLFSLGLAIFKPDLITYLEQRK
EPWNARRQKTVAKHPAGSLHFTAEILLEHDINDSFQKVILRKSGSCDLNTLRLKKDYQRV
GNCKGQKSSYNGIHQCLSATRSKTCQYNKCGKAFGLCSIFTEHKKIFSREKCYKCEECGK
DCRLSDFTIQKRIHTADRSYKCEECGKACKKFSNLTEHNRVHTGKKPYKCEECGKTFTCS
SALTKHKRNHTGDRPYKCEECHKAFRCCSDLTKHKRIHTGEKPYKCKECHKAFRCCSDLT
KHKRIHTGEKPYKCNECGKAFMWISALSQHNRIHTGEKPYICEECGKAFTYSSTLISHKR
IHMELRPYKCEECGKTFKWFSDLTNHKRIHTGEKPYKCEECGKSFTCSSNLIKHKRIHME
VRPYKCEECGKTFKWFPDLTNHKRIHTGEKPYKCEECGKTFTCSSSLIKHKRSHTGDRPT
SAKNVAKPLGGSQTLLNIR
Download sequence
Identical sequences A8MUV8
ENSP00000447987 gi|226958478|ref|NP_001152994.1| ENSP00000447987 NP_001152994.1.87134 NP_001152994.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]