SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000453557 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453557
Domain Number 1 Region: 398-661
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-49
Family YWTD domain 0.0000000000968
Further Details:      
 
Domain Number 2 Region: 103-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.0001
Further Details:      
 
Domain Number 3 Region: 283-394,666-711
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 142-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000353
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 5 Region: 26-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000124
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 6 Region: 196-232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 7 Region: 66-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0000954
Further Details:      
 
Domain Number 8 Region: 234-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 9 Region: 274-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000916
Family LDL receptor-like module 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453557   Gene: ENSG00000130164   Transcript: ENST00000557933
Sequence length 948
Comment pep:novel chromosome:GRCh37:19:11200138:11242201:1 gene:ENSG00000130164 transcript:ENST00000557933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPWGWKLRWTVALLLAAAGTAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQ
ETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGK
CISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEW
PQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDE
FQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMAR
DCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQD
PDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYT
SLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLA
VDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPA
KIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILE
DEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQ
PRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVA
TQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGN
EKKPSSVRALSIVLPIATELGLWSRGQLCDRACLSLQCSSSSFAWGSSFYGRTGGLRTST
ASTLTTPSIRRPQRMRSTFATTRTATATPRDRWSVWRMTWREHLPGVPSLPRTLPETSPA
LFYSKTEKTKALPARALFYIFIHLGGRTGFGQCPCNGLGWDFGFFLSS
Download sequence
Identical sequences H0YMD1
ENSP00000453557 ENSP00000453557 ENSP00000453557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]