SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000456112 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456112
Domain Number 1 Region: 249-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-25
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 14-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 390-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.69e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 445-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.48e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 193-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.65e-21
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 296-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000265
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 492-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000311
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 155-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000235
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456112   Gene: ENSG00000260513   Transcript: ENST00000569383
Sequence length 524
Comment pep:known chromosome:GRCh37:HG736_PATCH:57187307:57207557:-1 gene:ENSG00000260513 transcript:ENST00000569383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRPGPPGSREMGLLTFRDIAIEFSLEEWQCLDCAQRNLYRDVMLENYRNLVSLGIAVS
KPDLITCLEQNKESQNIKRNEMVAKHPVTRSHFTQDLQPEQGIKDSLQKVIPRTYGKCGH
EKLQFKKCCKSVGEYEVHKGGYSEVNQCLSTTQNKIFQTHKYVKVFGKFSNSNRDKTRYT
GNKHFKCNKYGKSFCMLSHLNQHQVIHTREKSYKCKECGKSFNCSSNHTTHKIIHTGEKP
YRCEECGKAFSWSANLTRHKRTHTGEKPYTCEECGQAFRRSSALTNHKRIHTGERPYKCE
ECGKAFSVSSTLTDHKRIHTGEKPCRCEECGKAFSWSSNLTRHKRIHTREKPYACEECGQ
AFSLSSNLMRHRRIHTGEKPYTCEECGQDFRRSSALTIHKRIHTGERPYKCEECGKVFSL
SSTLTDHKRIHTGERPYKCEECGKAFSLSSTLTDHKRIHTGERPYTCEECGKAFNCSSTL
MQHKRIHTGEKPYKCEECEQAFKWHSSLAKHKIIHTGEKPYKCE
Download sequence
Identical sequences Q96JC4
NP_150376.1.87134 NP_150376.1.92137 XP_011513906.1.92137 XP_011513910.1.92137 XP_016868266.1.92137 9606.ENSP00000333776 ENSP00000333776 ENSP00000456112 ENSP00000333776 ENSP00000456112 ENSP00000324518 ENSP00000333776 gi|149274617|ref|NP_150376.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]