SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000457704 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457704
Domain Number 1 Region: 242-302
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-26
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 8-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-24
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457704   Gene: ENSG00000256825   Transcript: ENST00000540096
Sequence length 358
Comment pep:putative chromosome:GRCh37:12:133707570:133778955:1 gene:ENSG00000256825 transcript:ENST00000540096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLTKP
DVILRLEKGEEPWLVEREIHQETHPDSETAFEIKSSVSSRSIFKDKQSCDIKMEGMARND
LWYLSLEEVWKCRDQLDKYQENPERHLSIPRVLSLPARHTKLTVGMATRVRTASIWVPPL
QERNSSWDRIRKLQGQESILGQGTPGLQPLPGTPRQKQKSRRIEKVLEWLFISQEQPKIT
KSWGPLSFMDVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSLGYQHTKPDIIFKLEQ
GEELCMVQAQVPNQTCPILKAGKSKAKVLAGLVSGEGLLCASKMTPCCCILWRHSLEN
Download sequence
Identical sequences A0A088AWK7
ENSP00000409295 ENSP00000457704 ENSP00000457704 ENSP00000457704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]