SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000458215 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458215
Domain Number 1 Region: 599-1046
Classification Level Classification E-value
Superfamily RNI-like 1.47e-72
Family 28-residue LRR 0.0000327
Further Details:      
 
Domain Number 2 Region: 32-120
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-22
Family Pyrin domain, PYD 0.0049
Further Details:      
 
Domain Number 3 Region: 199-286,315-372
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000103
Family Nucleotide and nucleoside kinases 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458215   Gene: ENSG00000262009   Transcript: ENST00000575084
Sequence length 1065
Comment pep:known chromosome:GRCh37:HSCHR19LRC_PGF2_CTG1:55164556:55188552:-1 gene:ENSG00000262009 transcript:ENST00000575084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKHRLEARPDLREFFSLNLRSHTRSTMTSPQLEWTLQTLLEQLNEDELKSFKSLLWAF
PLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAKAEMM
EDGQVQEIDNPELGDAEEDSELAKPGEKEGWRNSMEKQSLVWKNTFWQGDIDNFHDDVTL
RNQRFIPFLNPRTPRKLTPYTVVLHGPAGVGKTTLAKKCMLDWTDCNLSPTLRYAFYLSC
KELSRMGPCSFAELISKDWPELQDDIPSILAQAQRILFVVDGLDELKVPPGALIQDICGD
WEKKKPVPVLLGSLLKRKMLPRAALLVTTRPRALRDLQLLAQQPIYVRVEGFLEEDRRAY
FLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTG
LFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQMSVFHREDLERLGVQESDLRLFLDGD
ILRQDRVSKGCYSFIHLSFQQFLTALFYALEKEEGEDRDGHAWDIGDVQKLLSGEERLKN
PDLIQVGHFLFGLANEKRAKELEATFGCRMSPDIKQELLQCKAHLHANKPLSVTDLKEVL
GCLYESQEEELAKVVVAPFKEISIHLTNTSEVMHCSFSLKHCQDLQKLSLQVAKGVFLEN
YMDFELDIEFERCTYLTIPNWARQDLRSLRLWTDFCSLFSSNSNLKFLEVKQSFLSDSSV
RILCDHVTRSTCHLQKVEIKNVTPDTAYRDFCLAFIGKKTLTHLTLAGHIEWERTMMLML
CDLLRNHKCNLQYLRLGGHCATPEQWAEFFYVLKANQSLKHLRLSANVLLDEGAMLLYKT
MTRPKHFLQMLSLENCRLTEASCKDLAAVLVVSKKLTHLCLAKNPIGDTGVKFLCEGLSY
PDCKLQTLVLQQCSITKLGCRYLSEALQEACSLTNLDLSINQIARGLWILCQALENPNCN
LKHLRLWSCSLMPFYCQHLGSALLSNQKLETLDLGQNHLWKSGIIKLFGVLRQRTGSLKI
LRLKTYETNLEIKKLLEEVKEKNPKLTIDCNASGATAPPCCDFFC
Download sequence
Identical sequences ENSP00000414273 ENSP00000458168 ENSP00000458310 ENSP00000459870 ENSP00000459927 ENSP00000460480 ENSP00000460652 ENSP00000461744 ENSP00000474577 XP_011524898.1.92137 ENSP00000329568 ENSP00000458168 ENSP00000458215 ENSP00000458310 ENSP00000458962 ENSP00000459596 ENSP00000459698 ENSP00000459959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]