SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000459216 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459216
Domain Number 1 Region: 351-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.74e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 407-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 519-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.8e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-18
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 7 Region: 17-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-18
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 8 Region: 206-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000399
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459216   Gene: ENSG00000258405   Transcript: ENST00000421239
Sequence length 590
Comment pep:known chromosome:GRCh37:19:52956829:53015407:1 gene:ENSG00000258405 transcript:ENST00000421239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHEEAAQKRKGKEPGMALPQGRLTFRDVAIEFSLAEWKFLNPAQRALYREVMLENYRNL
EAVDISSKRMMKEVLSTGQGNTEVIHTGMLQRHESYHTGDFCFQEIEKDIHDFEFQSQKD
ERNGHEASMPKIKELMGSTDRHDQRHAGNKPIKDQLGLSFHLHLPELHIFQPEEKIANQV
EKSVNDASSISTSQRISCRPETHTPNNYGNNFFHSSLLTQKQEVHMREKSFQCNETGEAF
NCSSFVRKHQIIHLGEKQYKFDICGKVFNEKRYLARHRRCHTSEKPYKCNECGKSFSYKS
SLTCHRRCHTGEKPYKCNECGKSFSYKSSLTCHHRCHTGEKPYKCNECGKSFSYKSSLRC
HRRLHTGIKPYKCNECGKMFGQNSTLVIHKAIHTGEKPYKCNECGKAFNQQSHLSRHHRL
HTGEKPYKCNDCGKAFIHQSSLARHHRLHTGEKSYKCEECDRVFSQKSNLERHKIIHTGE
KPYKCNECHKTFSHRSSLPCHRRLHSGEKPYKCNECGKTFNVQSHLSRHHRLHTGEKPYK
CKVCDKAFMCHSYLANHTRIHSGEKPYKCNECGKAHNHLIDSSIKPCMSS
Download sequence
Identical sequences Q96N58
ENSP00000459216 ENSP00000459216 ENSP00000459216 gi|153791870|ref|NP_001093164.1| NP_001093164.1.87134 NP_001093164.1.92137 XP_016881791.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]