SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000461425 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000461425
Domain Number 1 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-25
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 2 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 2-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-24
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 4 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.81e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 350-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.26e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 8 Region: 507-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.19e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000108
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461425   Gene: ENSG00000160229   Transcript: ENST00000344519
Sequence length 573
Comment pep:novel chromosome:GRCh37:19:20959231:20990128:1 gene:ENSG00000160229 transcript:ENST00000344519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLQFRDVAIEFSLEEWHCLDMAQRNLYRDVMLENYRNLVFLGIVVSKPDLITHLEQGK
KPSTMQRHEMVANPSVLCSHFNQDLWPEQSIKDSFQKLILRRHKKCGHDNLQLKKGCESV
DKCKVHKRGYNGLNQCLTTTQSKMFQCDKHGKVFHQFSNTNRHKIRHTGKNPCKFTECGK
AFNRSSTFTTHKKIHTGEKPYKCIECGKAFNRSSHLTTHKIIHTGEKRYKCEDCGKAFNR
SSNLTTHKKIHTGEKPYKCEECGKAFKRSSILTTHKRIHTGEKPYKCEECGKVFKYLSSL
STHKIIHTGEKPYKCEECGKAFNWSSHLTTHKRIHTGEKPYKCEECGKGFKYSSTLTKHK
IIHTGEKPYKCEECGEAFKYSCSLTAHKIIHTGKKPYKCEECGKVFKHSSPLSKHKRIHT
GEKPYKCEECGKAFSRSSILTTHKIIHTGEKPYECEDCGKAFNRSSNLTKHKKIHTGEKP
YKCEECGKAFKCSSILTTHKRIHTADKPYKCEECGKDFKYSSTLTRHKKIHTGGKPHKCN
KCGKAFISSSNLSRHEIIHMGGNPYKCENVAKP
Download sequence
Identical sequences Q6ZN08
ENSP00000461425 ENSP00000461425 ENSP00000461425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]