SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000464502 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464502
Domain Number 1 Region: 7-133
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-26
Family Ankyrin repeat 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464502   Gene: ENSG00000264936   Transcript: ENST00000584215
Sequence length 496
Comment pep:known chromosome:GRCh37:HG1287_PATCH:146529622:146534763:-1 gene:ENSG00000264936 transcript:ENST00000584215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHTEGHALLRAVGQGKLRLARLLLEGGAYVNEGDAQGETALMAACRARYDDPQNKARMV
RYLLEQGADPNIADRLGRTALMHACAGGGGAAVASLLLAHGADPSVRDHAGASALVHALD
RGDRETLATLLDACKAKGTEVIIITTDTSPSGTKKTRQYLNSPPSPGVEDPAPASPSPGF
CTSPSEIQLQTAGGGGRGMLSPRAQEEEEKRDVFEFPLPKPPDDPSPSEPLPKPPRHPPK
PLKRLNSEPWGLVAPPQPVPPTEGRPGIERLTAEFNGLTLTGRPRLSRRHSTEGPEDPPP
WAEKVTSGGPLSRRNTAPEAQESGPPSGLRQKLSRMEPVELDTPGHLCPDSPESSRLSLE
RRRYSASPLTLPPAGSAPSPRQSQESLPGAVSPLSGRRRSPGLLERRGSGTLLLDHISQT
RPGFLPPLNVSPHPPIPDIRPQPGGRAPSLPAPPYAGAPGSPRTKRKLVRRHSMQTEQIR
LLGGFQSLGGPGEPGR
Download sequence
Identical sequences Q69YU3
ENSP00000314103 ENSP00000464502 NP_001034977.1.87134 NP_001034977.1.92137 9606.ENSP00000314103 gi|89941470|ref|NP_001034977.1| ENSP00000314103 ENSP00000475189 ENSP00000475189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]