SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000464835 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464835
Domain Number 1 Region: 406-520
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.4e-18
Family Mannose 6-phosphate receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 208-257
Classification Level Classification E-value
Superfamily EF-hand 0.0000389
Family Calmodulin-like 0.08
Further Details:      
 
Domain Number 3 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000419
Family LDL receptor-like module 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSP00000464835
Domain Number - Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 127-221
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00523
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464835   Gene: ENSG00000130175   Transcript: ENST00000591946
Sequence length 535
Comment pep:known chromosome:GRCh37:19:11546222:11547316:1 gene:ENSG00000130175 transcript:ENST00000591946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTCKEKG
RKERESLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVEMLRTVK
EEAEKPEREAKEQHQKLWEEQLAAAKAQQEQELAADAFKELDDDMDGTVSVTELQTHPEL
DTDGDGALSEAEAQALLSGDTQTDATSFYDRVWAAIRDKYRSEALPTDLPAPSAPDLTEP
KEEQPPVPSSPTEEEEEEEEEEEEEAEEEEEEEDSEVQGEQPKEAPPPLSPPQPASPAEE
DKMPPYDEQTQAFIDAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYS
QCYELTTNEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWIGPDHDKFSAMKYEQGTGCWQ
GPNRSTTVRLLCGKETMVTSTTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL
Download sequence
Identical sequences K7ELL7
ENSP00000466134 ENSP00000464835 ENSP00000466134 NP_001276032.1.87134 NP_001276032.1.92137 NP_001276033.1.87134 NP_001276033.1.92137 XP_011526432.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]