SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000464872 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464872
Domain Number 1 Region: 328-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.17e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 280-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 482-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 2-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.12e-20
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 7 Region: 162-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000213
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 8 Region: 222-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000129
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464872   Gene: ENSG00000175322   Transcript: ENST00000590202
Sequence length 540
Comment pep:known chromosome:GRCh37:18:14104720:14132429:-1 gene:ENSG00000175322 transcript:ENST00000590202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLTFRDVAIEFSPEEWKCLDPAQQNLYRDVMLENYRNLVSLAVYSYYNQGILPEQGIQ
DSFKKATLGRYGSCGLENICLWKNWESIGEGEGQKECYNLCSQYLTTSHNKHLTVKGDKE
YRIFQKKPQFLSAAPTEPCIPMNKYQHKFLKSVFCNKNQINFNHDSNISKHHSTHFLENY
YNCNECEKVFYQSSKLIFPENIHIQKKPYNSNECGETSDPFSKLTQHQRIYIGESSQRCN
KKCIIVFSQSHLKGHKIINTGEKSVKYKERGKAFTRGLHLGHQKIHTGEKPYKCKKCDKA
FNKSSHLAQHQRIHTGEKPFKCKECGKAFNRGSYLTQHQRIHTGERAFKCEECGKAFNRG
SYLTQHQRIHTGEKPFRCKECGKAFNRSSYVTQHQRMHTGEKPFKCKECGKAFNRASHLT
QHQRIHTGEKHFKCKECGKAFNRGSHLTRHQRIHTGEKSFKCEECGKAFIWGSHLTQHQR
VHTGEKFFKCKECGKAFTRSSHLTQHQRIHTGEKPFKCKECGKAFNRRSTLTQHQIIHTR
Download sequence
Identical sequences Q8TB69
gi|289666793|ref|NP_660330.2| NP_660330.2.87134 NP_660330.2.92137 XP_016881051.1.92137 XP_016881052.1.92137 XP_016881053.1.92137 XP_016881054.1.92137 9606.ENSP00000307908 ENSP00000464872 ENSP00000464872 ENSP00000464872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]