SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000466051 from Homo sapiens 69_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466051
Domain Number 1 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-23
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 2 Region: 447-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.54e-22
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 4 Region: 3-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.45e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 5 Region: 167-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-20
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 6 Region: 336-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.22e-19
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 8 Region: 493-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 112-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000139
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466051   Gene: ENSG00000176222   Transcript: ENST00000587539
Sequence length 552
Comment pep:known chromosome:GRCh37:19:44376515:44388116:-1 gene:ENSG00000176222 transcript:ENST00000587539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVPLTFSDVAIDFSQEEWEYLNSDQRDLYRDVMLENYTNLVSLDFNFTTESNKLSSEK
RNYEVNAYHQETWKRNKTFNLMRFIFRTDPQYTIEFGRQQRPKVGCFSQMIFKKHKSLPL
HKRNNTREKSYECKEYKKGFRKYLHLTEHLRDHTGVIPYECNECGKAFVVFQHFIRHRKI
HTDLKPYECNGCEKAFRFYSQLIQHQIIHTGMKPYECKQCGKAFRRHSHLTEHQKIHVGL
KPFECKECGETFRLYRHMCLHQKIHHGVKPYKCKECGKAFGHRSSLYQHKKIHSGEKPYK
CEQCEKAFVRSYLLVEHQRSHTGEKPHECMECGKAFGKGSSLLKHKRIHSSEKLYDCKDC
GKAFCRGSQLTQHQRIHTGEKPHECKECGKTFKLHSYLIQHQIIHTDLKPYECKQCGKAF
SRVGDLKTHQSIHAGEKPYECKECGKTFRLNSQLIYHQTIHTGLKPYVCKECKKAFRSIS
GLSQHKRIHTGEKPYECKECDKAFNRSDRLTQHETIHTGVKPQKCKECGKAFSHCYQLSQ
HQRFHHGERLLM
Download sequence
Identical sequences Q494X3
ENSP00000466051 ENSP00000466051 ENSP00000466051 gi|154759253|ref|NP_001028891.2| NP_001028891.2.87134 NP_001028891.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]