SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM002190-PA|EEB09846.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM002190-PA|EEB09846.1|hypothetical
Domain Number - Region: 15-86
Classification Level Classification E-value
Superfamily Prefoldin 0.0497
Family Prefoldin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM002190-PA|EEB09846.1|hypothetical
Sequence length 121
Comment protein Phum_PHUM002190|DS234986.1:541898:542435:1|gene:PHUM002190
Sequence
MYIIYLLINLKSNDTEYQINKTYKRSRKKETKSPEEVNMKLKSNNAVIKSHQSILKFVKK
KKTKKEKIKENLSKSRRDADKDIDETATTTGTTTGTTTGTIKDSDFVGGKTKNKKKWFVK
I
Download sequence
Identical sequences E0V8Z0
vb|PHUM002190-PA|EEB09846.1|hypothetical 121224.XP_002422584 XP_002422584.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]