SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM002910-PA|EEB09859.1|RalA-binding from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM002910-PA|EEB09859.1|RalA-binding
Domain Number 1 Region: 143-321
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM002910-PA|EEB09859.1|RalA-binding
Sequence length 610
Comment protein 1-A, putative|DS234988.1:54619:57320:-1|gene:PHUM002910
Sequence
MEFESPDVEKDFPGLYASDLSKKCNESDFSDEAHDKSFKKDLIIGKKKDKKDSKKDRGYA
ALEGESSVDEDTDLKSPCKSKKSKTFKFSSKKAEKKEKIKDKDKDKDVDKKDKEKKDKDK
VKSKEKKKIKNSEEILDSNENHNVFGVNLSTAVERNGCLDGVPIPLVVRNCIDCIHSFGL
NLDGLYKILGMKSKVLAVKKMYNARENVSLGECDVPVATCLLKLFLKELPDSLLTTELLA
RFEEAGAIMELDLREKTLQNLLAQLPVVNKILLGWLINHFDIVTMHEKHNKLNAQSIAMT
FSPVLQMSHRLLTAFLCHCKPLFSNITIERYIPPLCPGSAFPEKPDEISLELKKQELLLN
QLHREMSEGFVSKKKEEQLWEVQRIVTQLKRKLRSFHKFSEINTVVKSFEEDCKPNVETS
CENKINVTEKNVSPIQLNLKLSNSKENLNDSKNEEGVPNKGNKLNSTSPEKVVKKEKSPN
QSSSPEIPPSTNKILKESQFPSDLNLEQLKCELEYKELLKFQTALKNRIAQEKELISELN
TKILFYGKDVLNSPKTETFTNVEKIEKDCETLQKKIKGLLLKIFEERLACIKLKVYINIL
TIPEKGMQEC
Download sequence
Identical sequences E0V903
vb|PHUM002910-PA|EEB09859.1|RalA-binding 121224.XP_002422597 XP_002422597.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]