SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM003560-PA|EEB09894.1|histone from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM003560-PA|EEB09894.1|histone
Domain Number 1 Region: 19-150
Classification Level Classification E-value
Superfamily Histone-fold 6.45e-57
Family Nucleosome core histones 0.0000006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM003560-PA|EEB09894.1|histone
Sequence length 153
Comment H3, putative|DS234988.1:201049:201621:1|gene:PHUM003560
Sequence
MRRGTENDVANEKRGARMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYR
PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVG
LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Download sequence
Identical sequences E0V938
XP_002422632.1.24195 XP_002422650.1.24195 vb|PHUM003560-PA|EEB09894.1|histone vb|PHUM004150-PA|EEB09912.1|histone

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]