SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM003570-PA|EEB09895.1|histone from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM003570-PA|EEB09895.1|histone
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily Histone-fold 1.47e-32
Family Nucleosome core histones 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM003570-PA|EEB09895.1|histone
Sequence length 121
Comment H4, putative|DS234988.1:202472:202894:1|gene:PHUM003570
Sequence
MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGGPKKHDTYDTEVAHNPLI
E
Download sequence
Identical sequences E0V939
121224.XP_002422633 vb|PHUM003570-PA|EEB09895.1|histone XP_002422633.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]