SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM004120-PA|EEB09909.1|sorting from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM004120-PA|EEB09909.1|sorting
Domain Number 1 Region: 358-480
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.79e-24
Family Regulator of G-protein signaling, RGS 0.0019
Further Details:      
 
Domain Number 2 Region: 576-695
Classification Level Classification E-value
Superfamily PX domain 0.0000000000000824
Family PX domain 0.0042
Further Details:      
 
Weak hits

Sequence:  vb|PHUM004120-PA|EEB09909.1|sorting
Domain Number - Region: 505-571
Classification Level Classification E-value
Superfamily Tropomyosin 0.0108
Family Tropomyosin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM004120-PA|EEB09909.1|sorting
Sequence length 916
Comment nexin, putative|DS234988.1:263333:267204:1|gene:PHUM004120
Sequence
MNSVFYLICLIFIAFIALYPIFLWFSLLCLVFVAAILLAISGTVTVQIMLSMKHTARYVN
VLSSFSNFHKYIPQSYNNHVHKTKKRLPVIFGRSVDIALQELLDLIVRDLISSWLENLTF
SYKKLQFSFKKEIWYALGKLNERLINIDETKLIAGDMVSKITSHFEKIRLVNSGNDFSKQ
FYISHHLQSIEKELNYLRKISELILVTFFSNYLINHACNKNLLIEILTCKVFFPCIALLT
DPDYINQKILEYMEQVVQTNNLHQNSCSHAESFQEFIQLITSSDDANHLKRVRYSIMTEI
MQATTIQNLKKVKEVDSEKDEISIKKLKRYLGQLKFAKLQCENRLRDLDCPGFANDSENV
VVPFEKILENSFGRKMLYNFLENGGQETYLSFWVAVEELRSTVKSHWHQIGAEIYYTFIH
SQEAPIKVEKSVRRRIESFLLGNSGPEAFYEVQENIVQLLKEKVYPNFVLTDFYNQFLQH
IESTKQDLNNENQSVFENDKVDSVEQNGYAKNKLNQLQERLNNKSQALQALRLSLKPESR
VLSGLEKEVQNLEGEKRQLEAHLTRTEVWEEHLGKWRVVVQSAEVSADKECPHFVLVVHV
LEDELNYDAISTGWVVLRKLSEFHELHKKLSQVWNGVKNLELPSQSPKFLFGKHSDKASL
DKAKNQIQKYLEFVLQDERLNTSEAIYTFLSPSSESLKLSNVPGVSSPKKNRFSLSTLFK
TSSNQGNGEGSKDSDEEDYSLLDENEVKLGGGGGGEGKDAVVEPLYALLSEIFDLRGVFR
WLRKTLITFVQITYGRTISRQVRETVSWLFSEQMVHYYIKFFIQSWWPNGNLAKQQRTRT
KEEKQNTRANAKYLFVNNTPEVLNNLVGQQNAKRGAIKVFEILQDVRLNKQLVYDLLEIL
IYEIFPEIKRKGGIYK
Download sequence
Identical sequences E0V953
vb|PHUM004120-PA|EEB09909.1|sorting XP_002422647.1.24195 121224.XP_002422647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]