SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM004190-PA|EEB09916.1|histone from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM004190-PA|EEB09916.1|histone
Domain Number 1 Region: 22-153
Classification Level Classification E-value
Superfamily Histone-fold 6.68e-57
Family Nucleosome core histones 0.0000006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM004190-PA|EEB09916.1|histone
Sequence length 156
Comment H3, putative|DS234988.1:278882:279463:1|gene:PHUM004190
Sequence
MRPMKSLTGNDVANEKRGARMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Download sequence
Identical sequences E0V960
vb|PHUM004190-PA|EEB09916.1|histone XP_002422654.1.24195 121224.XP_002422654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]