SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM004630-PA|EEB09931.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM004630-PA|EEB09931.1|conserved
Domain Number 1 Region: 215-350
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-37
Family Third domain of FERM 0.0001
Further Details:      
 
Domain Number 2 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-36
Family Second domain of FERM 0.000048
Further Details:      
 
Domain Number 3 Region: 36-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000434
Family First domain of FERM 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM004630-PA|EEB09931.1|conserved
Sequence length 358
Comment hypothetical protein|DS234989.1:41825:43422:1|gene:PHUM004630
Sequence
MIENVSRRAFITSSGSYNVRASEQAKERRRKTIDSVVIFLDDTQHTFRIDKHAKGQELLD
AVFLHLELIEKDYFGLQFVDNGNLKIYNYYFTVVFSKKAILEIIFLVKFYVMDPSKLQEE
YTRYHFYLQVRKDILSGRLIVPTSAACLLASYMVQSELGDYNPVDHSYGYLSTLALIPNQ
NEELERKICELHKLHKGQTPADAEYNFLDHAKRLEMYGVDLHKARDSSNKEIYLGVSSIG
LVVFQNNIKVNTFSWSKIVKISFKQKQFFVQLRREQSENYDTLLGFNMVSYRSCKSLWKC
CVEHHTFFRLQSPQLRSRRFPLGLRFGIGSRFSYSGKTEFQTVEEGKQRAKMERNFVR
Download sequence
Identical sequences E0V975
vb|PHUM004630-PA|EEB09931.1|conserved XP_002422669.1.24195 121224.XP_002422669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]