SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM004660-PA|EEB09934.1|Vigilin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM004660-PA|EEB09934.1|Vigilin
Domain Number 1 Region: 734-805
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.2e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 2 Region: 586-660
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.17e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 3 Region: 225-302
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 4 Region: 653-729
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00015
Further Details:      
 
Domain Number 5 Region: 1046-1122
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0002
Further Details:      
 
Domain Number 6 Region: 1115-1190
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.78e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00022
Further Details:      
 
Domain Number 7 Region: 139-224
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.31e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00021
Further Details:      
 
Domain Number 8 Region: 444-544
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.97e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00059
Further Details:      
 
Domain Number 9 Region: 968-1039
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000438
Family Eukaryotic type KH-domain (KH-domain type I) 0.00033
Further Details:      
 
Domain Number 10 Region: 306-372
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000121
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 11 Region: 353-439
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000497
Family Eukaryotic type KH-domain (KH-domain type I) 0.00021
Further Details:      
 
Domain Number 12 Region: 801-882
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000789
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 13 Region: 874-967
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000101
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Weak hits

Sequence:  vb|PHUM004660-PA|EEB09934.1|Vigilin
Domain Number - Region: 111-153
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0542
Family Eukaryotic type KH-domain (KH-domain type I) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM004660-PA|EEB09934.1|Vigilin
Sequence length 1281
Comment putative|DS234989.1:54925:60556:1|gene:PHUM004660
Sequence
MQNSVSEGAPYEPPSPIVASAPYNNEAASTSFDSNGSPSSSAETNAYSYDEVFPALPQNP
VSISTSVNHHGQRNNKMRIGSSIVTQVFVIPHEESKFDLSEKFGESESMRTCHHIMQATG
ATIEISSNKDQSLTFLVTGKLNSVAEAKRRILTCFQTQGDIMLNIPKEHHRYLLGKGGQK
LKELEKVTGCKISVPNASDPSDAIKIIGSKEGIEKAVHEIKVTSDEQSKQAYERISVPKM
YHPFICGGHNEKINQLMQETNVRINVPPTSVQNNEITIAGEKEGVQVAKDKILAIYKEME
KKCSQVCVEVPKSQHRHVIGFKGNTIAEILQKTGVSVEMPPSDSTTDTITLRGPQDKLGL
ALDMVYSKANSVLSTTVNAPAWLHKYVIGRKGANIKKITQDLSKGVHVEFTDNKIKIEGP
REEVEKAQAELDKVVQELQSTHTFEELNVDPKYYKHIIGKGGTNVNRLKEDTGVLINIGE
EDGSSSNIIRIEGNKDGVLFVKKKLQAMVTKLETETEKIINIDHRFFPSIIGSKGENIRE
IKENYNQVQIIFPSSGKIILKNFFFFFDDVEKCSAHLNKIVKELAEENFMLEVPIFKQFH
KFVIGKGGANIKKIRDETQTKIELPGEDDRSDVIRIIGREENANLAKERIQKIQGELANI
VTEEITIPPKFYNSLIGPGGKLVHSISEECGGVQIKFPTSESRSDKVSIKGPKEDVEKAK
QQLEALKNEREAASYTVEIKAKPQHHKFLIGKNGAKIKKIRDSTGARIVFPSEKDEDKET
IIIIGRKEQIEKAKLELEKTIKEIDNLTEAEMTVNPVHHKHFVSRRGEVIQQITNECGGT
VTISFPRPNCESDKVTLKGFKESIEMAKAKIENIVKELESMVTIECVIPQKHHRTVMGSK
GTKVQNITYDYKKINQSFCCLSPAEDYNNKEENGAVNGEVVKPCDIIKITGQPENCQAAK
EALEKLVPVTVEVPVAFDLHRSIIGKSGGSVRQLMDDFDVHIVLSPADQKLDCIKISGAP
ANVEKAKEALEERVRQLEKDKQDRQLKSFSLSVNVDPEFHPKIIGKKGAVISEIRSNYGV
QITLPKRGDPEEHIITIQGYEEKAIAARDHILKIVNELKERTKEEIEVDSRVHSRLIGQK
GRSIRKLMDKYQVEIKFPRQGDSNPNLVTIIGSEDNVWDAKEEILNLADNYLSDLPPAEY
LQRPQQYQLSLGEERGQGDGSGDGFVVRGGPWEQQQQQQQQQQQQQQAQRRPDTASIEDF
PSFGTAYCGEGHTITWGPRPR
Download sequence
Identical sequences E0V978
XP_002422672.1.24195 vb|PHUM004660-PA|EEB09934.1|Vigilin 121224.XP_002422672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]