SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM009090-PA|EEB09988.1|GRB2-associated-binding from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM009090-PA|EEB09988.1|GRB2-associated-binding
Domain Number 1 Region: 5-117
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-27
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM009090-PA|EEB09988.1|GRB2-associated-binding
Sequence length 706
Comment protein, putative|DS234991.1:714421:717594:-1|gene:PHUM009090
Sequence
MSGSNNEIVYEGWLTKSPPSKRIWKARWRRRWFVLRHSGELPGQFFLQYYTDRNCRKLKG
TIDLDQCEQVDVGLKFENSKQNYPHMFDVKTPKRIYYLAADSETDMNKWVDCVCQVCVEF
NEESNESLLTPNDTGEPESPSLSPTSTVSGPYIPISECISGKPLNTPVGSSNGSNKVALK
DLYQAQSVRQNKLNTIKQTVCDDDISNVIIINRKNILTNFPAKQEDSVNNGKITNIESAK
KMAKHRNLENRPPDLKLSETMSPDVYDSPRKIVLDKSEWSPANWSSGVPVPNWDTFPNNS
EISEEAYFSPGEIGSWSVVQRFGKLTIVDSKLPIVTNSLNRAIKQRAQPDTSSLRRPVAP
PRPPKPSHLVVQENLHSYLNLDKSDTKASDTIKTSVPSQDENPIVDEMYDIPRSHQVHNE
ETTPGGRSSNRHNYLNAAPSEKGNVFIYDFAEVQSNNSQTETIPGEPTSPRSEGSGSGVV
YSNLPSPLKTDISTPPAVNRELKPTRKTSESGVSNEPSPGGSFTGLIPKETSPGGPYTSG
TSVELGVNGPPSIDRTLKPKKLPSDGAIKLSKPPEGNLSLRRVRAGPSPVPQQGSSSTLP
NNLRNDRTRSEYSGSEDDHRKSPDNEPIYYFESSNNRYIPAGKKFTEIQYIDLDLDSDVN
NTNTTNAAQTAEPTATVYKTVDFLKTEAFNRTRQEVEEERNKLPAE
Download sequence
Identical sequences E0V9D2
XP_002422726.1.24195 121224.XP_002422726 vb|PHUM009090-PA|EEB09988.1|GRB2-associated-binding

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]