SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM012900-PA|EEB10042.1|cAMP-dependent from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM012900-PA|EEB10042.1|cAMP-dependent
Domain Number 1 Region: 371-679
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-81
Family Protein kinases, catalytic subunit 0.000000606
Further Details:      
 
Domain Number 2 Region: 76-202
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.93e-29
Family cAMP-binding domain 0.00082
Further Details:      
 
Domain Number 3 Region: 213-331
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.24e-29
Family cAMP-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM012900-PA|EEB10042.1|cAMP-dependent
Sequence length 692
Comment protein kinase catalytic subunit, putative|DS234994.1:21000:23724:1|gene:PHUM012900
Sequence
MTNVFESSNILKMEEKKDENQNIIFLKCCAVKKMDVGKPKRTPGKPLIKNTINKKKEGVS
GNSSVTKKLEKASDIKLPKYEKDLKTIEFIKDSIRGNEFLKDGLFASPNIIKAVVDAMYI
KSVPANEYIIREGEVGFHMYVVAKGSIDVFKGDVKVNTLGPKKVFGELALLYNSKRNATI
LANTDCDFWVLDRKIFLQIMKKSGMQMTENRVKFLRSVPLLSSLNTEVLVKMTDLLKLRT
YAAGSVILKQGDEGSLFYIITGGTVSVTITQPDGTVKQGPILKTGDFFGEKALLKDEKRA
ATVIAQEPGVECLTLDRIHFIEYLGGLQEVRDANFDKKFSLEKNDASGIIIINKILKKIF
FVLYLKHLNCLTEFSHLLLDDLEIIGTIGVGAFGRVEFVKCKNDKNIVFALKCVKKIDVV
ALGQEQHMHNEKENMMMCRSPFIVRLYNTYKSSKYVYFLMEFCQGGDVWSLLQKKKFFDE
SLARFITGCMVEAFEYLHARGIAYRDLKPENVIFDAKGYAKLADFGFSKKLKPTEKTWTF
AGTPEYVAPEIILNEGHNRAVDYWTLGIFIHELLVGKPPFRGHNHSQTYTLILKGIDSVL
FPRLISKTAQILIKKLCKRAPAERLGFQREGVTDIKKHRWFQNFNWEALEKTLLVSPHVP
KLKGTTDLSYFDKYPKDKEIPPDEFGDWDSEF
Download sequence
Identical sequences E0V9I6
121224.XP_002422780 vb|PHUM012900-PA|EEB10042.1|cAMP-dependent XP_002422780.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]