SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM014910-PA|EEB10063.1|cAMP-dependent from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM014910-PA|EEB10063.1|cAMP-dependent
Domain Number 1 Region: 187-515
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-84
Family Protein kinases, catalytic subunit 0.0000000000331
Further Details:      
 
Domain Number 2 Region: 30-183
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.4e-42
Family Regulator of G-protein signaling, RGS 0.00000102
Further Details:      
 
Domain Number 3 Region: 553-669
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000385
Family Pleckstrin-homology domain (PH domain) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM014910-PA|EEB10063.1|cAMP-dependent
Sequence length 695
Comment protein kinase catalytic subunit, putative|DS234994.1:473299:507238:-1|gene:PHUM014910
Sequence
MADLEAVLADVSYLMAMEKSKCTPAARASKKILLPDPSVRSVMHKYLEKKGEVNFDKIFN
QILGYLLFKDFCENCCEEPVPQLRFYEEIKAYEKLECMEERKKLAREIYDNFIMKELLAH
SHDYSKDSVAHVQKFLMKNEVPVNLFEPYIEEIFNHLRGEPFKKFLESDKYTRFCQWKNL
ELNIQLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGIDCPFIVCMTYAFHTPDKLFFILDLMNGGDLHYHLSQHGVFNEPEMKFYAA
EVILGLEHMHRRYIVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAP
EVLSKGTAYDSSADWFSFGCMLYKLLKGHSPFRQHKTKDKHEIDRMTLTMNVELPESFSR
DLRSLLEGLLQRDVDKRLGCKGNGADEVKEHSFFNGIDWQQVYLQKYTPPLIPPRGEVNA
ADAFDIGSFDEEDTKGIKLTEADQDLYKNFPLVISERWQGEVAETVFETINQEADKAEQK
KKAKQKLKFDADEKESDCILHGYIKKLGGPFASAWQTRYAKLYPNRLELHPESGNTKPEL
IFMDQIEDVSPDMVQVKSEQCIVVRTKIGKVVLTNPDEIGLKEWALSLRSAHKRSLELLG
SMAKKAGKIYGTDEKQGNNKNMTMISTGTRNTNGN
Download sequence
Identical sequences E0V9K7
121224.XP_002422801 vb|PHUM014910-PA|EEB10063.1|cAMP-dependent XP_002422801.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]