SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM018510-PA|EEB10103.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM018510-PA|EEB10103.1|conserved
Domain Number 1 Region: 99-235
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.53e-17
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.027
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000324
Family Ubiquitin-related 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM018510-PA|EEB10103.1|conserved
Sequence length 316
Comment hypothetical protein|DS234995.1:298118:299378:1|gene:PHUM018510
Sequence
MSNLNLKVKTKTGQLVVKELSKFNTIHDLKVQLSQRCKISCNALHILSGFPPKPINLTNG
SLTLDAIGLKNGDTLIVEEKVEYIQNKENEYPISNDDKTAHILEEQLTCPGILMRKVVPA
DNSCLFTSIGFTVTGKVDTMCGMYMRKIIADYVAQDTETYSEAILGKSPKAYCEWIMKPD
SWGGAIELSILSGHYGIEMDVVDTVNAIINRFGEDKNYNQRIFLIFDGVHYDPLYLEPSL
VSDIQTIFPMSDDNVFQEAKLLAQQAKSSRQYTDVNKFYLKCLDCQIIMKGQLEAQDHAK
TSGHINFGEVASMFET
Download sequence
Identical sequences E0V9N4
XP_002422841.1.24195 121224.XP_002422841 vb|PHUM018510-PA|EEB10103.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]