SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM020380-PA|EEB10141.1|C-terminal from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM020380-PA|EEB10141.1|C-terminal
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily PH domain-like 0.00000938
Family Phosphotyrosine-binding domain (PTB) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM020380-PA|EEB10141.1|C-terminal
Sequence length 60
Comment pdz ligand of neuronal nitric oxide synthase protein, putative|DS234996.1:172209:172554:1|gene:PHUM020380
Sequence
MRRIRYEFKAKGIKKKKVTVEVSVDGVRVTLKKKKKVRRVLFYYYYYYYYYYHYYHHYYY
Download sequence
Identical sequences E0V9T5
vb|PHUM020380-PA|EEB10141.1|C-terminal XP_002422879.1.24195 121224.XP_002422879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]