SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM020390-PA|EEB10142.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM020390-PA|EEB10142.1|hypothetical
Domain Number 1 Region: 2-51
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000875
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM020390-PA|EEB10142.1|hypothetical
Sequence length 73
Comment protein Phum_PHUM020390|DS234996.1:172628:173627:1|gene:PHUM020390
Sequence
MDENKLLVMHHPIYRIFYVSHDSQDLKIFSYIARDGASNVFKCNVFKSNKKGRREGEKKF
SRYTNHYRVSEKL
Download sequence
Identical sequences E0V9T6
XP_002422880.1.24195 vb|PHUM020390-PA|EEB10142.1|hypothetical 121224.XP_002422880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]