SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM022250-PA|EEB10158.1|voltage from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM022250-PA|EEB10158.1|voltage
Domain Number 1 Region: 314-469
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.24e-23
Family cAMP-binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 1718-1905
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.15e-22
Family cAMP-binding domain 0.0062
Further Details:      
 
Domain Number 3 Region: 777-963
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.11e-21
Family cAMP-binding domain 0.012
Further Details:      
 
Domain Number 4 Region: 1471-1708
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-19
Family Voltage-gated potassium channels 0.0081
Further Details:      
 
Domain Number 5 Region: 1277-1418
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-18
Family cAMP-binding domain 0.0063
Further Details:      
 
Domain Number 6 Region: 638-777
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000824
Family Voltage-gated potassium channels 0.0054
Further Details:      
 
Domain Number 7 Region: 156-299
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000017
Family Voltage-gated potassium channels 0.0056
Further Details:      
 
Domain Number 8 Region: 1036-1268
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000017
Family Voltage-gated potassium channels 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM022250-PA|EEB10158.1|voltage
Sequence length 1915
Comment and ligand gated potassium channel, putative|DS234996.1:409770:418941:-1|gene:PHUM022250
Sequence
MDFLEVYSLPPGNKPKYIPKIYDSEKVENNKRFNRFLLFILLGVYIRFIMTLYDIGFRPR
SRSLETFNYITVVLDAFYFLDVISQIIYRKKWPKSTSRLKKNAPYLSRLVWRNNMFLPRP
IWMLVFDIISLLPFSLVKNVYVDSTYIFLWEFPSALRVYRVLAHYGSEAKKISPSTNKSL
GLFLRAGMFWMILSHTLACIWGYVLDKIDINFSIRDNSTNDLKDEKPFHYYIFLFYFVFT
GLTNIGFGDIIPTSDGEKLLESLVMLVGFILLKGYLIATLTSVLTEKARRLTYLKFRLSL
MSFEMARNLNLNLISLHYKKGIGILNRLLLTLPDSFSIQVYNDLFVAALNTSLLFRSCDE
FSKRAIARIMRVELFMAGDAILKRRKFNSKMFYVRKGTIHIMSYQDDATEVMTFGAGTIF
GQISLLLSLPAKSEVHAATFCEIHSLSRKRLFRVLKDYAHAKKIIQNVHKNMLLNAMADK
SDKHKRKAPGNLLTTYSFYKVPIETSKLARDDICIVTRCPYIFMPDTIFIKAWNVLITII
IIFICFYYPYQAAFAREYKKDLEPLFIIVDLVFLLNLYLSLSTSVIRENVLFSSLRDIVP
ARLTTLNTVCEIIAIIPAHYFIWHTNRLKSVILCLKCVMFYKVHLVFKTAEWSYGKTTIF
LLRLIKYVLYFLFGAYIIGIVFYMEACYVDPCLQDSWYVTTSSPNRSEPIWVSFYFAIIV
ISGTGFGDIVPNNITDIIYVIGFIIFGVLLLIYLIADYSANLSLSREPRINKCNSFRQEF
IELAERVNSFLRSQKMLKSERTRVRHFLNLQWERNSLFTHAHTPTQGYEFTSENRLFYDM
PKHLLYTINQFTRTDGSEILGNLLNSSIRRIFPPHEVVIYAGEICDSLIILEQGYCEVTY
GKDTSITKIIHAGQDIGLVEFMLDMTSFCHVRTLTHCVIIKLQSKNLIRAFSLNPIIAAE
FKKSIEIFAKSPILKDAKKNQPVLLHLTVRKAVQESFYRFRYYRKQGGNQELRDPYLKLG
LCQWLRYLLFRVTVLPYGNFLKRWEFSRCIFAFLSSLIFPCLPYFELEFGFLYYLSIILD
ITAWVDMYFRCHVCYYNKQNILVTHPLWTLGHYLKGNFVLDFIFSFPFDRILYRPIYDVN
DEAIVSSNANNLLRILRVGQVYRIPVTLSTAGVDFLSPPHLYWVIATATILTTTFVNLAT
IEFPTLPSYVFIVNFYWTCTTAFGVGFGDIVGSTQGLMIYVNIVILVCKYYKPYLYFNYV
TVIIASYLTRINMNLTMFQQGMSHLISFLKVENVEPMLRKHIINHFEYIWKKNRAFSNLG
SAFHRLLCSKLDEIHFQSGAAIYKPGDVLSQFYIVHQGEVTLVGKTENETVELGRSKIFG
IFKNLPTDTVSLSAVATKNVTILGIDSLMLYSILKNYKKSHDDQINDQDIEFEFQDALYM
SNTISTEWQEGTQSLSTSKYYYQLVYLTYNYSKFILVFYVVLSLYTANIVTFNLAFQYNS
KIAYIIDLFIEFLFVVKIVIEFFKGYLNDFGEFVSDLRLISKRYMKTASFYLDILSTFPF
EIFSLIMDKEDKRNYLATWLRMTKLLRLYNVWYFFNLRFDTLSVNMILLKIMANTVWTTT
LVHQCSCLWYFVSCPNAYCPNSKLWNRIKRTAPDNTEYVNCFYFIIAIMTTTGLGDLSAT
TVTEIMCVIFFCFVFFFYTAIFIGEMVSSTNKYLFSKTKFEYEVEELKNYLIISEIPYEN
QKLILKYVVNLWRNEKGKQVPDILKFAPTYLVNEIKLSTYGGHIKKNPLFKNCSQNFQKQ
LIYLLIRTVFYFGDVIVFEGQASIEPLVDKTAYFVHSGQVVCKNCSDKTIYREYSFFGLS
QCVKESLPHHQTFVANSSCVILSLNITKAKFLIKFFPEDMKYIVDNVNAIESNLM
Download sequence
Identical sequences E0V9V2
vb|PHUM022250-PA|EEB10158.1|voltage XP_002422896.1.24195 121224.XP_002422896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]