SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM023250-PA|EEB10170.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM023250-PA|EEB10170.1|conserved
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000219
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM023250-PA|EEB10170.1|conserved
Sequence length 645
Comment hypothetical protein|DS235000.1:2130:4384:1|gene:PHUM023250
Sequence
MSSWRKYWFVLEKRLLLYYKSKLEYTNLSPCRGSLNMGLVTTVRPGSSSGPCIIHIVTRT
QSRAKNRACQEEWLQALLHSMALPLFPKIIKSPSSKQFNFLGGCTTSLDNISLNNNNNNN
WRNFGDEWTLPRKLNYSKRSQMMSGSYYGGSLDTAIWTKKFKSLQSSNVRNHNKKMEKLL
IFPKEINYEDFMMSSQRDIHNYNNNNENQMKFLCKNDYYGFDDEIRENDDENENENDDDD
INKKNYNPSADFIYGFSNKNKKRLLKTFSDNQLVKTDSIKNFNVNKKMNHKKDFENHFGH
IKNVLSRTQKEKSEKKLSTLGAPVKKRRQSFLQKVFKMKNNNNNIIDNDIQIPNEKSLDV
TVDNDEKDEVGEVLIDFKNENEEEECMNETVKETIENEKNQHGGDKKFKGDVKKNLAGSK
TILPDSALEELKMKLKTRDSLEKQEIEFINDENFNITDNFKPPSLPPRRVSRPVSPWHDV
PSNNAPIYSEKKQFFSHQATVKFKDTNTSQNLEITECNKHGKINHEENCSRTNVTNSCED
STVKSQPLNTVEKERNEDDLSTLLEQLTKITVAPLAEPEFSDRSSSPELNKYNGKNFNFD
PDYDIPRPHRPFNLKVSNEYIEKENDIKASHFLSIEPDSLEIEEM
Download sequence
Identical sequences E0V9W4
121224.XP_002422908 vb|PHUM023250-PA|EEB10170.1|conserved XP_002422908.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]