SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM024330-PA|EEB10196.1|Sorting from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM024330-PA|EEB10196.1|Sorting
Domain Number 1 Region: 226-303
Classification Level Classification E-value
Superfamily PX domain 1.44e-20
Family PX domain 0.0031
Further Details:      
 
Domain Number 2 Region: 3-83
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-18
Family SH3-domain 0.0013
Further Details:      
 
Weak hits

Sequence:  vb|PHUM024330-PA|EEB10196.1|Sorting
Domain Number - Region: 339-533
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0223
Family FCH domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM024330-PA|EEB10196.1|Sorting
Sequence length 540
Comment nexin-9, putative|DS235001.1:2268:3929:-1|gene:PHUM024330
Sequence
MSKVRALYDFSAEPGSTELSISAGDILTVTRRDIGEGWLEGSNSDGKVGLFPAAYVEDLN
SEPPNIPPPPFPSAFGAGEPKYEQPNYMYSEVPAQDWTNSSDWQSQSAQPEWDDGDEEWD
DDSETGTTHPVSQGPASAHLQISKSMSGSDLGRVNVGKSFNRFSTFVKSGSESYILGNLK
VSGIIQDKDKIVIYDTSEGIMWEPITEPYSCMIASPKKESKLRGLKSFIAYQYKHFDWLH
ERLEEKFSIIPIPPLPDKQISGRYEEQFIEHRKTQLQAFVNCVCRHPILSRSSVWNHFIT
CTDEKQWKLGKRKAERDELVGAKFFLALNAPEKELETFIVEQETEDCSKFITAMDTSIKI
LSSTSYDQTKKYQGLYKKDYEKIGQAFQSLSYAFSLDKTPGNPRMNLTNAITTTSAIYLE
IGKMFEDQPKNDWEPLGDVLHIYKGIISSFPDIINVHRNTLNKHKECERLAHEAKMSPSE
LKDVKKRADVVSYALLAEINHFHNERAVDFKGAMQSFLAEQIKFYQNIVDKLNVALSAYD
Download sequence
Identical sequences E0V9Z0
121224.XP_002422934 XP_002422934.1.24195 vb|PHUM024330-PA|EEB10196.1|Sorting

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]