SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM024490-PA|EEB10202.1|phosphoinositol from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM024490-PA|EEB10202.1|phosphoinositol
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-23
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM024490-PA|EEB10202.1|phosphoinositol
Sequence length 225
Comment 4-phosphate adaptor protein, putative|DS235001.1:33967:34986:-1|gene:PHUM024490
Sequence
MEGVLWKWTNYWSGWQMRWFVLKNGILSYYKSQEEVDQGCKGSLKVSACEIIVHSTDHTR
LEISIPGEQHMYLKASSKQERQKWLVALGSSKACMTTRGRKEHFDIGNGDSLKSKKFELK
LYCDLLMQQVHQVKTCVSDKNNIDVNSLNEATNLLSVTCDTFITTLDDCMKLSDANFLLE
LSHHPPTDTLVPLGCHQKGKPTVPNMKRSSSYESPPDLKPNERKT
Download sequence
Identical sequences E0V9Z6
121224.XP_002422940 XP_002422940.1.24195 vb|PHUM024490-PA|EEB10202.1|phosphoinositol

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]