SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM026770-PA|EEB10252.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM026770-PA|EEB10252.1|hypothetical
Domain Number 1 Region: 276-459
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.54e-24
Family cAMP-binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 1818-2013
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.55e-24
Family cAMP-binding domain 0.004
Further Details:      
 
Domain Number 3 Region: 828-1016
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.93e-23
Family cAMP-binding domain 0.018
Further Details:      
 
Domain Number 4 Region: 1324-1496
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.55e-18
Family cAMP-binding domain 0.005
Further Details:      
 
Weak hits

Sequence:  vb|PHUM026770-PA|EEB10252.1|hypothetical
Domain Number - Region: 1140-1259
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00111
Family Calcium ATPase, transmembrane domain M 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM026770-PA|EEB10252.1|hypothetical
Sequence length 2031
Comment protein Phum_PHUM026770|DS235004.1:526711:532973:-1|gene:PHUM026770
Sequence
MNSVKTLKNPELQAIYKKSKASTEDVPGWKVFIFLHQDFFWRTVISILVTFTYLMRSTEY
SFKVSMEYYEYLEYLNSCIYFVDTLSATLHYSMPKTRKLRHGEKRKLFFLVIDYFTLIPF
YTMYMYFVFDFSGPFGKIIVHLRLNVCLRIYHLYYLFSETRYWVYKIKIYFILTLIKIII
LYVVFTHLFCCLNFINKSYALQEQCLKDSISCIIEGELYILALFCQTQISETNFYPMSVE
NAFDTITFFFGFYFTYGCTLPLLFFTFFNYGLEYLNFSNKYNQLKMILRNWTSNKAVENK
IIDYYELVRKYGESKNKPEIINYFPLCLQKNIFCEIYWEALRHSDLFEDLSLGCKRSLAL
CMTTRFILPNTTLLKMNALKYKFMYLESGLLQIMAQENDASPVLSLSDGTVLGELSIFLQ
LKSKAVLRTAKLCIIHFLSYKSFLKAMIYYPKEMKKINKKIKYRLKLAKTIHKSKAIIHY
QTSTESDKVKEKADIKWLKQQYKSIKELHMANQREILAEEKLIIRQDKQVKPTEFKTQLG
YTSIFLRLLVINDEVVNKYEAVCLRTKCPWLIDPNAKFLKTWNHIVITVSFLIGVLFPIF
IGWYAKVPSSLLNFSSFVIVIYIIDLGFLIFTGIKIKNTLITKFETLIFYRFTTLTFYIN
VIAAIPFDAIANLLLSADDEMYKSGLFFLIYFLKFYIFVKAFHVWCYEKNSKPFKTVFFK
NMAFLAILTYWASMVFKLTGVECVFFTCSQNDWYRVFERAMGPQYKDYASVFLVIFLVFN
LSQTIFTSDSKVSILIYIVALFIFRINFLVWRAEIFSSFVLERFHLVKYNRLSQLVADFV
SDRQVKGRITKRVINTLLFQWQFDKGNYISEENRILDNLPRYVLDQLDQATIYETIHKCK
LFKMENESLKKDLLKFCHRLTLPVNSILTTFGTQSMTLYIIHKGYVQMNSFLENDKIHNI
ATPFYKKSGTIFPILIAFNQYPSVLNVRTITDCELLVLRLEDFLSTLIKHNIFKDFVDAV
KTTDLNALGNASPGLSIVDANNVKIPEKKLNFFKKFKLIDTLVQYIILGRAIDSRGKRYI
YWECFRLLSFAIELLAWPLIFGMLSIYDKPKKALIFFLVFLESFTWIDFFLKMKVAFYNQ
KGIYVTHPFRTFTHYITTTFFTDLLGTVPYFHILYLIKINKYNYHWTMFMTHMLLRITGW
YKFFSLFNYISSITILTFKVEFLHFLFLIIVLLNWYINCLIYAFNSGFHFHYLNRKDPVA
INYYKIVFTSLRYLARGKYSFNMLNLITMLNVISVPLVSWVSEIVLYSFYTMNFVAFYWR
FSDYHYYLKSFQKFLNGEKIEDMFIKEAVDHYEHVWILHKGIDFKSVFSKFPAILHEDLM
MSVYEQTWNYVSCFSKANNSFYRILSAAVVEVYLKKGSIILFEKQVNGIIYFVHEGQCYV
NKKLMTLNRGTIFGNIQGEDVMKNTITAKTHVTLLKIDSGIFFKLMDNFIQTKHVFEAEI
KKYEDFVEGLLEDTTEEIFYDVTIEKTNEKNAESKFEPIKKTTSAVSRDSQYHSLSESRH
RKRGRMFNPFSVTSSSLHVVFFIVSILTVVLIPIFIGLRYFTAWSITVIYMLDAIWIVKI
IVTLRTPVVDSKTGLLIYEGKKIFYNYLIQTGGLPCDILCVLPLEVIRIIVNLIINDKNF
FCFIYYYYLLRTLRIFYIKKIFNKLKKKLAVKAPTRLFIIFMLNLFYVNTFTCISVIFKD
LDGDNLKNCDYRYTIEKMTFFKTEYNCVVHIFCGSNIYSCMPENNLQIFLAFIISICGYF
ARAILCSETLAVYHFLNQSKYDQIKQLDEFENYLEMRNISPALLYTIKRYFVDLIDICKE
KALPSFLVTAPDYIKFHIMSDLYLHHLTTCFVFEGVDRSFLIQLTTRLERYIYFPGNYIT
EQGDVDQNMYFVQEGEVYCLEKDANFPALERPVNVYSKDEYFGILQGIFPYYPHTYTHRA
RILTVILTLNFHHWDDMRKANPDIAEMIYTKVSQKGSYANDIYNNYASQNV
Download sequence
Identical sequences E0VA46
vb|PHUM026770-PA|EEB10252.1|hypothetical 121224.XP_002422990 XP_002422990.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]