SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM029790-PA|EEB10285.1|IQ from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM029790-PA|EEB10285.1|IQ
Domain Number 1 Region: 357-544
Classification Level Classification E-value
Superfamily Sec7 domain 1.44e-64
Family Sec7 domain 0.0000053
Further Details:      
 
Domain Number 2 Region: 552-687
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000154
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM029790-PA|EEB10285.1|IQ
Sequence length 848
Comment motif and Sec7 domain-containing protein, putative|DS235005.1:162295:167456:1|gene:PHUM029790
Sequence
MSAQGNVRMCAGAGYELSQDLLDKQIEVLEKKYGGEKARNAALTIQRAFRRYALTKKFDS
ITAMAKAERRLSRRLQENFDSEVANFEKELQGGSKFLQARPAPLRSSSMREKRHLDSTSL
PRSQSGCCDLGHQSIDYYTPTGLQPCILHTPPLSGSYRDNTHYYTPQEAFTEANHPVSHY
PQCTHSSQSLQRDAFGRKSTTVVQRNTPPHQNGNSWNRQGSPSPSSYPSRPNSANKKIPP
EVPKRTSSISCRSTPDSLTRTNGLGKAFENGSLSSVQSSGSDSSLSTDRVMAEGSVDMES
RNRTSPVWKRKAQPTSPEHNMSDTSADISRKELSNTHTNSYQQVHDHSVTDSQHTLYKYR
VGLNLFNKKPERGIAYLIKRGFLSNTPQAVASFLITRKGLSRQMIGEYLGNLQSEFNMEV
LQCFSAELDLAGMQIDVALRKFQTYFRMPGEAQKIERLMEVFSQRYCSCNREVVSRLRSP
DTVFVLAFAIIMLNTDLHTPNLKPERRMKLEDFIKNLRGIDDCGDIDRDMLSGIYERVKG
NEFKPGNDHVTQVMKVQSNIVGKKPNLALPHRRLVCYCRLYELPDMYKKERPGVHQREVF
LFNDLLVVTKIFSKKKNSVTYTFRESFPLCGMVVSTFEVPYYQYGIRLSQRVGGKVLITF
NARNEHDRCKFAEDLRESISEMDEMENLRIEQELERQKSGRGRGGAPPENRDSGVADVEV
CPYSSQAQDDNKRPLIESQLKRSALSNSLLDIHEQFVTEKPQQRRGSVGSLDSGMSISFQ
STSASTVSRDSSPQNLQVLGGGGVGPGGFKNTKMMNHQQSFLGGIFAKRERKSSRAGQEE
CFTRTTEV
Download sequence
Identical sequences E0VA79
vb|PHUM029790-PA|EEB10285.1|IQ 121224.XP_002423023 XP_002423023.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]