SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM042890-PA|EEB10467.1|Rho/RAC from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM042890-PA|EEB10467.1|Rho/RAC
Domain Number 1 Region: 488-714
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-50
Family DBL homology domain (DH-domain) 0.000014
Further Details:      
 
Domain Number 2 Region: 715-842
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-25
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 
Domain Number 3 Region: 371-435
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000733
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM042890-PA|EEB10467.1|Rho/RAC
Sequence length 1385
Comment guanine nucleotide exchange factor, putative|DS235014.1:1921:13593:1|gene:PHUM042890
Sequence
MLLPGDANAAALIHRSNILFSSAWVLPVVPGKTEKQFKILRTIDDADSDEDIITDYLSES
DRTGPPITSGIGGPGPLVPIISVTPHSPGNENLQHLHKIHDTIQQMRHVSGYNSNNSGLT
LRLNQSNRLSCSCPSLNDAGSDPELFTNSNSTPTHGTGKGSSKLWLASKNILDADFNRRR
SWTALEDLSSGRGIKPCRQRSMSLSSLDSEQDDPFSDHQDGGSTSLLVAAGKSVTINTRR
TNRNNGGASTHSLNEADLQNDFNVVIAKREAENMRLLSARLPLQKSISTPSIIAVRDIVP
EVVSEESTVTLPVGQLRPSGTESETEEEVMSSLLDPSQHPFVVDMPPSSQIHLHQLFEES
YTAHSEKRRKRGSLFFRKKKDKVKKVVHQWVSVSYGFSYNCDSCSKPLTNKPALYCDNCT
KRVHANSCKDQLLECVKPKTSKGGSKGPQSLSKRGSTSQQSNSSNRKTTFCYSPWKRVAT
KLGVKEPESWTPTVGKDILKRLDDKEIKRQEHMYEFILTEKHHCLTLRVMQKVFVEGIKK
YFQLGAIVNRMFPRLADLTEIHFKFLYLLRQRQKVSPLIETFSDILLEQFSGTCAQKLKS
AYGEFCSHHSDAVGIYKYHSDNDRRFGGFVRQCQQNPLLKKKGIPECILFVTQRLTKYPL
LIEALIKSTKDNKIEQERLQRALALVKEILVEVNAQVAEKEKEDRKLEIYNRIDAKSFTV
RRGIKFKKSDILSDNRKLKFEGTAMLMQGRSKMQYVVVIVLSDVLFFLQDNNTKYSFFTP
DNKTGVVSLQKLLVREKAGQDSKGIYLISSHPAEPEMFELKVHKPKDKQTWIQAIRSAVQ
SCPEEEDEEGGTVLSNEDKQRMWEAKQAHIRQIVDILKQKTHEQALILEEKMALQLKLLA
ASGLTNVPEPPSYCHLVAENADTSSVWKKVISAVQEVSQLASSLYASGTNLSRSVSSVGE
RQSDAYVSPTLPKRAETFGGFDNTQVSGSKLGAILKKHKENSSGSSGIDNVDSNAKNEMD
PFFWRNAIISALPPDFAGASSSASSDIPALLTLGREQQLAAILLSHDVYTLLCIFWQQMT
SINNLQAQLAVYKEQLNSDEKDRKPTYRHNHQLEELRNIQDKLNQDKEAWLREKEIEEKE
LEEKRCKLFLLENQLREEQKDITKQREQLYRKMEMLTNQGILISPNMPVVTTPPIEEQGF
QTPPSSVEFRRKSDTQKWKSSSLGKTGSLPPNLISATNQQKVLPNLQIKQQLPLKLATNN
KPSSIAPAASSSGTPQMLPMKLSQTTESRRNMSGLSGIPSPSIHPGYQRLNSSNVPGGEQ
PSHSHSRTGSSPAAIMQNSPPSSPNTTKINTLTKNTYPKQQENPEEKLINFLPSFGMKNG
EKPQN
Download sequence
Identical sequences E0VAR1
121224.XP_002423205 vb|PHUM042890-PA|EEB10467.1|Rho/RAC XP_002423205.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]