SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM046570-PA|EEB10527.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM046570-PA|EEB10527.1|hypothetical
Domain Number 1 Region: 1014-1205
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.0012
Further Details:      
 
Domain Number 2 Region: 17-55
Classification Level Classification E-value
Superfamily WW domain 0.00000105
Family WW domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM046570-PA|EEB10527.1|hypothetical
Sequence length 1210
Comment protein Phum_PHUM046570|DS235019.1:18962:25250:-1|gene:PHUM046570
Sequence
MYANLTTGECVWDPPPGVPVKKTDDNQWWELFDQNTSRFYYYNAISQKTVWHRPSNCDII
PLAKLQTLKQNTEPEGEDGNEECKSKESVGTQTPGKCVRPPRPVINSHPKDFLFFFFVFF
CFCRLRFLAKLKRLPVVLQGDQGDLIIILIYTFILTGIHITIMGVIVANRRLRKRQINLR
SSDSSSRTSLDNHRILESPRQNRYQGTSLPTSTSASAIDKKPLQEINSQPTRVENSSVFK
SVNKSCGGNTTTSQSIISGFKPGTNISIAKQKSFDVETSLGIGGCYSNYGHENLRGRSKT
EKHLQAPKETIITGNGSDLARSYSFIQRRDVSLDEEDSMHEKYFLPPSQSGMRSIESTPQ
ARRKQLHLGKLLGILFGVASKSAKDLDLASITPSRTRKIHKSNESNRNRECKRYSKENEY
QSGSSENDSSNTSLSPTTSPSSPVSSSRKNNRLNQGNVFSNVETPSFGRHSNHSRSNGGK
MQSYEDKKESQRKIPLKETYRERDENVEDIFKKQLTWDSGESKERPKKNYNETRNALRED
LYKNKIGDYRQNDSKDLLRENGNHGNVSSHVKYYSMERGMEKGNSTLLYSNLDYQPYNME
IKNQSHLFPLQQYILEQAKLSGCYKFGDPLNDEMDSLHSEDEASVGRPDYDSDEFADDEG
MSNQGDSSSQEYLHDPNYSEQEEFLKRYENYSRECKNDVEYIESLESRMAVNTIPQVVYY
SGVASPYPPRLPPHGVPHSTSETQHASLKRKKETSTGSLSSHFSSIVEKTENANRPVSLP
SQSIPEDTTDHRCESPRAASLSRDKKLPSESDIEEYAQGHLNIHKKGIFRKKFSVRDMLS
WSKDPIRKPMLVLSEKALKKDACELFKLVQIYMSDRKAKFGMTLNSVALDICNVGYSKPV
LRDELYIQICRQTTENPGKESLRRGWELMAICLNFFPPSAKFQTYLEGYLNRHRDPGFDF
PEVVKWPLHVQISHYATIGCKRLERIGANGKKPPRKPTIEEIDQSRHQIFRTSMFGSTLE
EVMYLQKERFPNRRLPWVQTVLSEEILRLQGAQTEGIFRVSADVDEVNSLKTKIDFWEVP
TETIDAHAPASLLKLWYRELYEPLIPDTLYNECVTHHDDPEFALAIVQRLPNLNRLVLCY
LVRFLQIFSRDEVVQITKMDASNLAMVMAPNCLRCTSQDPSVIFDNARKEMSFMKTLIQS
LDTSFMEGIF
Download sequence
Identical sequences E0VAX1
121224.XP_002423265 vb|PHUM046570-PA|EEB10527.1|hypothetical XP_002423265.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]